(data stored in ACNUC7421 zone)

EMBL: CR954246.AROE

CR954246.AROE        Location/Qualifiers
FT   CDS             32922..33746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PSHAa0031"
FT                   /product="5-dehydroshikimate reductase"
FT                   /function="2.2.1.1 : Aromatic amino acid family"
FT                   /EC_number="1.1.1.25"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85145"
FT                   /db_xref="GOA:Q3IDI6"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDI6"
FT                   /protein_id="CAI85145.1"
FT                   /translation="MDKYAVFGNPIKHSKSPAIHKQFAISLGEQIDYRAILAPIDNFEK
FT                   TVSNFFAQGGKGANVTMPFKEQAFAMADELTPLAKIVGAVNTLKKQADGTLLGDNTDGI
FT                   GFVSDLLANNVSITGKRILIIGAGGAARGVVLPLLDHQPQEVVIVNRTAEKAQNLAKLF
FT                   AQHGNVSGYGFNNLPENDYALIINSTSSSMNDELPALDQKHITNCEVAYDMFYSLQNTI
FT                   FMNWVAQYNSKTKLLDGSGMLVGQAAQAYYVWRNKMPAILPVVNALKQGALT"
     MDKYAVFGNP IKHSKSPAIH KQFAISLGEQ IDYRAILAPI DNFEKTVSNF FAQGGKGANV        60
     TMPFKEQAFA MADELTPLAK IVGAVNTLKK QADGTLLGDN TDGIGFVSDL LANNVSITGK       120
     RILIIGAGGA ARGVVLPLLD HQPQEVVIVN RTAEKAQNLA KLFAQHGNVS GYGFNNLPEN       180
     DYALIINSTS SSMNDELPAL DQKHITNCEV AYDMFYSLQN TIFMNWVAQY NSKTKLLDGS       240
     GMLVGQAAQA YYVWRNKMPA ILPVVNALKQ GALT                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page