(data stored in ACNUC7421 zone)

EMBL: CR954246.AROQ

CR954246.AROQ        Location/Qualifiers
FT   CDS             277864..278316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="PSHAa0264"
FT                   /product="3-dehydroquinate dehydratase (EC 4.2.1.10)
FT                   (3-dehydroquinase) (Type II DHQase)"
FT                   /function="2.2.1.1 : Aromatic amino acid family"
FT                   /EC_number="4.2.1.10"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85363"
FT                   /db_xref="GOA:Q3IDT2"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDT2"
FT                   /protein_id="CAI85363.1"
FT                   /translation="MAAKFKLLVINGPNLNMLGKREPDKYGSRTLSEIMSELTCAADSL
FT                   NVELTHFQSNSEQALIERIHDTWQAIDYIIINPAAFTHTSVALRDALLSVDIPFFEVHL
FT                   SNVHAREAFRHHSYFSDVAQGVICGLGAMGYHAALEAAVNQLQNSN"
     MAAKFKLLVI NGPNLNMLGK REPDKYGSRT LSEIMSELTC AADSLNVELT HFQSNSEQAL        60
     IERIHDTWQA IDYIIINPAA FTHTSVALRD ALLSVDIPFF EVHLSNVHAR EAFRHHSYFS       120
     DVAQGVICGL GAMGYHAALE AAVNQLQNSN                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page