(data stored in ACNUC7421 zone)

EMBL: CR954246.ASTA

CR954246.ASTA        Location/Qualifiers
FT   CDS             206587..207603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astA"
FT                   /locus_tag="PSHAa0195"
FT                   /product="arginine succinyltransferase"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /EC_number="2.3.1.109"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14675764; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85298"
FT                   /db_xref="GOA:Q3IFT8"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT8"
FT                   /protein_id="CAI85298.1"
FT                   /translation="MMILRPIQQSDYPALVKIAHESGHGFTSLPNNEKLLQKKIDHSVS
FT                   SFAKAATEPGDEGYLFVLEDTETGEVVGTSGIEAAVGLDDAFYHYHLSKVIHSSRTLNV
FT                   YKAVDILTLCNDYTGATELCTLFLKDAYRKNSNGKLLSKSRFMFIKQHQERFAQTVIAE
FT                   MRGVSDDNGSSPFWQWLEEHFFSMDFPTADYLTGIGQKVFIAELMPKYPIYVNLLSKNA
FT                   QAVIGKVHDNTRPAIELLKSEGFTFNGYVDIFDAGPTVEAKVDNIATIRNAKHFKVEIG
FT                   EPSGDTMVLLANEKLTDFRATVVPMTFDERMSSIVITQQVADALYLQAGDSVSATTI"
     MMILRPIQQS DYPALVKIAH ESGHGFTSLP NNEKLLQKKI DHSVSSFAKA ATEPGDEGYL        60
     FVLEDTETGE VVGTSGIEAA VGLDDAFYHY HLSKVIHSSR TLNVYKAVDI LTLCNDYTGA       120
     TELCTLFLKD AYRKNSNGKL LSKSRFMFIK QHQERFAQTV IAEMRGVSDD NGSSPFWQWL       180
     EEHFFSMDFP TADYLTGIGQ KVFIAELMPK YPIYVNLLSK NAQAVIGKVH DNTRPAIELL       240
     KSEGFTFNGY VDIFDAGPTV EAKVDNIATI RNAKHFKVEI GEPSGDTMVL LANEKLTDFR       300
     ATVVPMTFDE RMSSIVITQQ VADALYLQAG DSVSATTI                               338
//

If you have problems or comments...

PBIL Back to PBIL home page