(data stored in ACNUC7421 zone)

EMBL: CR954246.ASTC

CR954246.ASTC        Location/Qualifiers
FT   CDS             205294..206499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astC"
FT                   /locus_tag="PSHAa0194"
FT                   /product="acetylornithine transaminase (NAcOATase and
FT                   DapATase), PLP-dependent"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /EC_number="2.6.1.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85297"
FT                   /db_xref="GOA:Q3IFT9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT9"
FT                   /protein_id="CAI85297.1"
FT                   /translation="MTVNRELFDHVMVPNYAPSSVIPVRGEGSRVWDQQGREFIDFAGG
FT                   IAVNCLGHCHPALVGALKEQGEKLWHLSNVMTNEPALRLAKKMVDATFAEKVYFANSGA
FT                   EANEAALKLARRFALDQFGAEKSQIIAFNKGFHGRTFFTVTVGGQAAYSDGFGPKPGDI
FT                   VHCDYNDLAAFEALISDKTCAVMMEPLQGEGGIVSPTDEFAQGVRDLCTKHNALLIFDE
FT                   VQTGVGRTGNLYAYQGLNVVPDILTTAKALGGGFPIGAMITTTEIAQHLKVGTHGSTYG
FT                   GNPLACAVAEAAFDTVNTPEVLAGVTAKAALFNQLLTEINNKYHVFSEIRGQGLLIGAV
FT                   VSEQYKGRAKEFLVAGTEHGLMSLVAGADVVRFTPSLVIPEADIREGMARFEKAVASVV
FT                   SA"
     MTVNRELFDH VMVPNYAPSS VIPVRGEGSR VWDQQGREFI DFAGGIAVNC LGHCHPALVG        60
     ALKEQGEKLW HLSNVMTNEP ALRLAKKMVD ATFAEKVYFA NSGAEANEAA LKLARRFALD       120
     QFGAEKSQII AFNKGFHGRT FFTVTVGGQA AYSDGFGPKP GDIVHCDYND LAAFEALISD       180
     KTCAVMMEPL QGEGGIVSPT DEFAQGVRDL CTKHNALLIF DEVQTGVGRT GNLYAYQGLN       240
     VVPDILTTAK ALGGGFPIGA MITTTEIAQH LKVGTHGSTY GGNPLACAVA EAAFDTVNTP       300
     EVLAGVTAKA ALFNQLLTEI NNKYHVFSEI RGQGLLIGAV VSEQYKGRAK EFLVAGTEHG       360
     LMSLVAGADV VRFTPSLVIP EADIREGMAR FEKAVASVVS A                           401
//

If you have problems or comments...

PBIL Back to PBIL home page