(data stored in ACNUC7421 zone)

EMBL: CR954246.ASTD

CR954246.ASTD        Location/Qualifiers
FT   CDS             207620..209089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="astD"
FT                   /locus_tag="PSHAa0196"
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /function="2.2.3.2 : Degradation of aminoacids"
FT                   /EC_number="1.2.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12107143; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85299"
FT                   /db_xref="GOA:Q3IFT7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFT7"
FT                   /protein_id="CAI85299.1"
FT                   /translation="MTHPAQFINGQWSQGQGTEFSSVNPANNNVIFQANSATAEQVDAA
FT                   VSAAREAFYAWADKTFAERLEIVKAFAAQLKENSEELAITIAQETGKPLWETRTEAGAM
FT                   VGKIAISEKAFLERTGDVENAMPLGRAMIRHKPHGVVAVFGPYNFPGHLPNGHIVPALL
FT                   AGNTVIFKPSELTPKVAELTLKLWEKAGLPAGVINLVQGEVATGKALAAHKGIDGLFFT
FT                   GSSRTGHILHEQFAGQPGKILALEMGGNNPLIITDVEDTKAVVHDIIQSAFISSGQRCT
FT                   CARKLFLPTGSKGDVILERLITATKAIKVGNYDDADQPFMGSMISSAAAAGMVKAQNEL
FT                   VELGAQVLVELEHTVNTGFVTPGIIECTNISDFPDEEHFGPLLKVFRFDDFDQAIDKAN
FT                   DTSFGLSAGLLSDSAADYEHFLRRIRAGIVNWNRPITGASSAAPFGGIGASGNHRASAY
FT                   YAADYCAYPVASVELEKVAMPATLSPGLKID"
     MTHPAQFING QWSQGQGTEF SSVNPANNNV IFQANSATAE QVDAAVSAAR EAFYAWADKT        60
     FAERLEIVKA FAAQLKENSE ELAITIAQET GKPLWETRTE AGAMVGKIAI SEKAFLERTG       120
     DVENAMPLGR AMIRHKPHGV VAVFGPYNFP GHLPNGHIVP ALLAGNTVIF KPSELTPKVA       180
     ELTLKLWEKA GLPAGVINLV QGEVATGKAL AAHKGIDGLF FTGSSRTGHI LHEQFAGQPG       240
     KILALEMGGN NPLIITDVED TKAVVHDIIQ SAFISSGQRC TCARKLFLPT GSKGDVILER       300
     LITATKAIKV GNYDDADQPF MGSMISSAAA AGMVKAQNEL VELGAQVLVE LEHTVNTGFV       360
     TPGIIECTNI SDFPDEEHFG PLLKVFRFDD FDQAIDKAND TSFGLSAGLL SDSAADYEHF       420
     LRRIRAGIVN WNRPITGASS AAPFGGIGAS GNHRASAYYA ADYCAYPVAS VELEKVAMPA       480
     TLSPGLKID                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page