(data stored in ACNUC7421 zone)

EMBL: CR954246.ATOE

CR954246.ATOE        Location/Qualifiers
FT   CDS             complement(147810..149120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoE"
FT                   /locus_tag="PSHAa0136"
FT                   /product="putative short-chain fatty acid transport protein
FT                   (scFAT family)"
FT                   /function="2.4.1 : Fatty acid and phospholipid metabolism"
FT                   /function="1.2.8 : Other"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85240"
FT                   /db_xref="GOA:Q3IF33"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF33"
FT                   /protein_id="CAI85240.1"
FT                   /translation="MLNKIATPFTKLVERYLPDPFIFVILLSVITLVIASVFTPTTGIE
FT                   VLQAWGDGFWNLLSFAMQMLLVLITGYMLASTPPISKLLEKLATFANTAPKAIILVTLI
FT                   SLLASWLNWGFGLVIGALFAKAIAKHTRVDYRLLVASAYSGFVVWHGGLAGSIPLTIAT
FT                   EGHFLQSSMGIISTEQTLFAGFNIAILVGLFIIMPLVNRYMLPSAEESVYIDPALLKST
FT                   SPAIINITRPAQHLEQSKLLGITIGLLGLIYLGYYFLVAGGGLNLNSVIALFLFLAITL
FT                   HQTPHNLLNSLQQAIPSGAGIVIQFPFYAGIMAVMVDSGLAQQISSGFIAIADADSLPF
FT                   FSFISAGLVNMFVPSGGGQWAVQAPIVIPAAQALGADISRVAMAVAWGDAWTNLIQPFW
FT                   ALPVLAIAGLKAKDIMGFCVVQLFVTGVFISLMLSFY"
     MLNKIATPFT KLVERYLPDP FIFVILLSVI TLVIASVFTP TTGIEVLQAW GDGFWNLLSF        60
     AMQMLLVLIT GYMLASTPPI SKLLEKLATF ANTAPKAIIL VTLISLLASW LNWGFGLVIG       120
     ALFAKAIAKH TRVDYRLLVA SAYSGFVVWH GGLAGSIPLT IATEGHFLQS SMGIISTEQT       180
     LFAGFNIAIL VGLFIIMPLV NRYMLPSAEE SVYIDPALLK STSPAIINIT RPAQHLEQSK       240
     LLGITIGLLG LIYLGYYFLV AGGGLNLNSV IALFLFLAIT LHQTPHNLLN SLQQAIPSGA       300
     GIVIQFPFYA GIMAVMVDSG LAQQISSGFI AIADADSLPF FSFISAGLVN MFVPSGGGQW       360
     AVQAPIVIPA AQALGADISR VAMAVAWGDA WTNLIQPFWA LPVLAIAGLK AKDIMGFCVV       420
     QLFVTGVFIS LMLSFY                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page