(data stored in ACNUC7421 zone)

EMBL: CR954246.BHBD

CR954246.BHBD        Location/Qualifiers
FT   CDS             417320..418165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bhbD"
FT                   /locus_tag="PSHAa0399"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase
FT                   (Beta-hydroxybutyryl-CoA dehydrogenase) (BHBD)"
FT                   /EC_number="1.1.1.157"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8001771; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0399"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85497"
FT                   /db_xref="GOA:Q3IIH0"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIH0"
FT                   /protein_id="CAI85497.1"
FT                   /translation="MEVSIIGSGTMATGITQVLCLSNEVSKVNLIARTEEKALASKSTC
FT                   AKNISRLARKGKISDEQASFALEKLYCNAELVAVVNSDLIIEAIVEDFTAKMVLFSKLA
FT                   EFINDSVIVASNTSSLSITAFASVLPNPQNVVGLHFFNPAPIMELVEIIVGHETAPAKI
FT                   QLLQGLTKNLGKVPVVVQEAPGFVVNRMLIPMINEAVSILAEGVATADDIDKAMKFGAH
FT                   HPMGPLALADLIGNDVNLSIMETLYSETGDPKYRAHPLLRKMVRANHLGRKTKKGFFEY
FT                   "
     MEVSIIGSGT MATGITQVLC LSNEVSKVNL IARTEEKALA SKSTCAKNIS RLARKGKISD        60
     EQASFALEKL YCNAELVAVV NSDLIIEAIV EDFTAKMVLF SKLAEFINDS VIVASNTSSL       120
     SITAFASVLP NPQNVVGLHF FNPAPIMELV EIIVGHETAP AKIQLLQGLT KNLGKVPVVV       180
     QEAPGFVVNR MLIPMINEAV SILAEGVATA DDIDKAMKFG AHHPMGPLAL ADLIGNDVNL       240
     SIMETLYSET GDPKYRAHPL LRKMVRANHL GRKTKKGFFE Y                           281
//

If you have problems or comments...

PBIL Back to PBIL home page