(data stored in ACNUC7421 zone)

EMBL: CR954246.COAE

CR954246.COAE        Location/Qualifiers
FT   CDS             complement(395169..395801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="PSHAa0379"
FT                   /product="dephospho-CoA kinase"
FT                   /function="2.5.6 : Pantothenate and coenzyme A"
FT                   /EC_number="2.7.1.24"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11292795; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85477"
FT                   /db_xref="GOA:Q3IID1"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IID1"
FT                   /protein_id="CAI85477.1"
FT                   /translation="MSEQAVKVTNINNWVLGLTGGIGCGKTAVSNMLEALGICVVDADI
FT                   IARQVVEPGSEGLKAIVTHFGADILLADGNLNRSALRELVFSNNEHKNWLNTLLHPLIR
FT                   QQIIIDLNNATSPYVVLVAPLLFENGLDKYCNRTLLIDVPKNVQIERTVKRDNISLEQV
FT                   NSIIAAQMSREQKQQQADDILNNDRSLTLVKHDLIALHKGYLKLALK"
     MSEQAVKVTN INNWVLGLTG GIGCGKTAVS NMLEALGICV VDADIIARQV VEPGSEGLKA        60
     IVTHFGADIL LADGNLNRSA LRELVFSNNE HKNWLNTLLH PLIRQQIIID LNNATSPYVV       120
     LVAPLLFENG LDKYCNRTLL IDVPKNVQIE RTVKRDNISL EQVNSIIAAQ MSREQKQQQA       180
     DDILNNDRSL TLVKHDLIAL HKGYLKLALK                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page