(data stored in ACNUC7421 zone)

EMBL: CR954246.CPXR

CR954246.CPXR        Location/Qualifiers
FT   CDS             complement(391491..392180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="PSHAa0375"
FT                   /product="Transcriptional regulatory protein CpxR"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8294007; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85473"
FT                   /db_xref="GOA:Q3IID5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IID5"
FT                   /protein_id="CAI85473.1"
FT                   /translation="MKLLMIDDDTGLCELLSEYLTAQGFNVQSVHDGEQGLKLAQANDY
FT                   ALILLDVMLPTLDGFEVLKQLRQTKLTPVIMLTAKGEDFDRIFGLELGADDYIPKPFNH
FT                   RELLARVKAITRRIEHITTMNTTSSNKLVVNGVTINLAAREALIKQTTLTLTGTEYEIL
FT                   ALLAKRAGEVVSKEQISEDVLGRRLASFDRSIDMHVSNIRKKIAEHLPNELIKTIRGTG
FT                   YVFIQGE"
     MKLLMIDDDT GLCELLSEYL TAQGFNVQSV HDGEQGLKLA QANDYALILL DVMLPTLDGF        60
     EVLKQLRQTK LTPVIMLTAK GEDFDRIFGL ELGADDYIPK PFNHRELLAR VKAITRRIEH       120
     ITTMNTTSSN KLVVNGVTIN LAAREALIKQ TTLTLTGTEY EILALLAKRA GEVVSKEQIS       180
     EDVLGRRLAS FDRSIDMHVS NIRKKIAEHL PNELIKTIRG TGYVFIQGE                   229
//

If you have problems or comments...

PBIL Back to PBIL home page