(data stored in ACNUC7421 zone)

EMBL: CR954246.CSD

CR954246.CSD         Location/Qualifiers
FT   CDS             196948..198183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csd"
FT                   /locus_tag="PSHAa0186"
FT                   /product="putative cysteine desulfurase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.5.14 : Other"
FT                   /EC_number="2.8.1.7"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 10939241"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85289"
FT                   /db_xref="GOA:Q3IK63"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK63"
FT                   /protein_id="CAI85289.1"
FT                   /translation="MNITQLREQFPALMQSVNGKSPVFLDGPGGSQVPQSVLNAMTAYL
FT                   GYYNSNLGGAFFSSDKTVELMANARQAAADLLNAPSSQQIVFGPNMTSLTFSFSRAISR
FT                   DWQTGDEIIVTNADHFSNVSSWQQAAEDKGVKVNTALINETDCTLNMAQFESLLNSNTK
FT                   LVAVTYASNTTGSINNIKRIVELAHNVGALVYVDAVHYAPHELVDVQALDCDFLACSAY
FT                   KFFGPHLGMVYGKKEHLEGFTPYKVEPAKDVAPGRWETGTQSFEAMAGFIAAVDYIAAI
FT                   SELDDSHSRREKLSVAFAKTKQHEMALSEYFLTRLVNYPRIKLFGIDDLDRLNERTPTF
FT                   ALTFEGLEPRAVSECLGKQHICVWDGNFYAQGLCEQLGVLDKGGVVRIGCMHYNTTAEL
FT                   DQLFNLFDELLG"
     MNITQLREQF PALMQSVNGK SPVFLDGPGG SQVPQSVLNA MTAYLGYYNS NLGGAFFSSD        60
     KTVELMANAR QAAADLLNAP SSQQIVFGPN MTSLTFSFSR AISRDWQTGD EIIVTNADHF       120
     SNVSSWQQAA EDKGVKVNTA LINETDCTLN MAQFESLLNS NTKLVAVTYA SNTTGSINNI       180
     KRIVELAHNV GALVYVDAVH YAPHELVDVQ ALDCDFLACS AYKFFGPHLG MVYGKKEHLE       240
     GFTPYKVEPA KDVAPGRWET GTQSFEAMAG FIAAVDYIAA ISELDDSHSR REKLSVAFAK       300
     TKQHEMALSE YFLTRLVNYP RIKLFGIDDL DRLNERTPTF ALTFEGLEPR AVSECLGKQH       360
     ICVWDGNFYA QGLCEQLGVL DKGGVVRIGC MHYNTTAELD QLFNLFDELL G                411
//

If you have problems or comments...

PBIL Back to PBIL home page