(data stored in ACNUC7421 zone)

EMBL: CR954246.CUSA

CR954246.CUSA        Location/Qualifiers
FT   CDS             316904..320020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="PSHAa0305"
FT                   /product="cation efflux system protein cusA"
FT                   /function="4.2 : Detoxification"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12813074, 11222619; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85404"
FT                   /db_xref="GOA:Q3ILD1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILD1"
FT                   /protein_id="CAI85404.1"
FT                   /translation="MIAAIIRWSVLNRFFVLLLTVILIGGGLFAVKNTPVDALPDLSDV
FT                   QVIIKTSYPGQAPQVVQDQVTFPLTTAMLSVPGAQTVRGFSFFGDSYVYVIFDEKTDLY
FT                   WARSRVQEYLSQVASRLPATASAELGPDATGVGWIYLYALVDKTNQHDISQLRSLQDWF
FT                   LKFELQTVPGVSEVASVGGMVKQYQVTVDPDKLRAYGIPLSLIQTAIAQGNQEMGASVV
FT                   EMAEAEYMVTSTGYIKSVADLEAIPLGVNTNATPLQLRDVADIRLGPQMRRGIAELNGE
FT                   GEVAGGVVVMRFGENAQKTIELVKAKLESLKKGLPAGVEIVPVYDRSNLIKDAVDNLSS
FT                   KLLEELVVVALVCIVFLFHVRSSLVAIITLPLGILTAFLIMYWQGINANIMSLGGIAIA
FT                   IGAMTDGAIVMIENMHKHMEKTPLTDENRWQVVIDSASEVGPALFFSLMIITVSFMPVF
FT                   ILEAQEGRMFAPLAYTKTYAMAASAGLAITLVPVLMGYFIRGKVISEQKNPVNRMLVNA
FT                   YKPLLNAVLKFPKATLALATLIAVIGFYPVNKMGSEFIPPLDEGDLMYMPTTYPGISIG
FT                   KARELLQQTDKLIATVPEVLTVFGKVGRAETATDPAPLTMIETFIQLKPKDQWREGMTL
FT                   DKLKKELDSLVKFPGVTNAWVMPIKTRIDMLATGIKTPVGIKVAGPKLSEIQKIGQQIE
FT                   SILKDVPGTASVYSERVAGGRYIKVDINREKAARYSLNIADIQQVVATAIGGTNVTQTV
FT                   EGQERYPVNLRYPQGYRDSPEELMLLPIVTPAGQRIALADVAKVFIEDGPAGIKSENAR
FT                   LNGWSFIDIENIDIGTYVENAQQILHEQLILPAGYSITWAGQYEYMQRAKDKLAYVLPL
FT                   TLAIIVVLLYLNFRSFAEVLIIIVTLPLAMIGGIWLMYLEGFNFSVAVGVGFIALAGVA
FT                   VEIGVIMLVYLNQAYQEKITQAQQTGVPLNYEQLKQAITEGAGLRVRPVMMTVATIVIG
FT                   LLPVLYGTGTGSEIMSRIAAPMVGGMFSAVVLTLLVIPATYLLWRKRDL"
     MIAAIIRWSV LNRFFVLLLT VILIGGGLFA VKNTPVDALP DLSDVQVIIK TSYPGQAPQV        60
     VQDQVTFPLT TAMLSVPGAQ TVRGFSFFGD SYVYVIFDEK TDLYWARSRV QEYLSQVASR       120
     LPATASAELG PDATGVGWIY LYALVDKTNQ HDISQLRSLQ DWFLKFELQT VPGVSEVASV       180
     GGMVKQYQVT VDPDKLRAYG IPLSLIQTAI AQGNQEMGAS VVEMAEAEYM VTSTGYIKSV       240
     ADLEAIPLGV NTNATPLQLR DVADIRLGPQ MRRGIAELNG EGEVAGGVVV MRFGENAQKT       300
     IELVKAKLES LKKGLPAGVE IVPVYDRSNL IKDAVDNLSS KLLEELVVVA LVCIVFLFHV       360
     RSSLVAIITL PLGILTAFLI MYWQGINANI MSLGGIAIAI GAMTDGAIVM IENMHKHMEK       420
     TPLTDENRWQ VVIDSASEVG PALFFSLMII TVSFMPVFIL EAQEGRMFAP LAYTKTYAMA       480
     ASAGLAITLV PVLMGYFIRG KVISEQKNPV NRMLVNAYKP LLNAVLKFPK ATLALATLIA       540
     VIGFYPVNKM GSEFIPPLDE GDLMYMPTTY PGISIGKARE LLQQTDKLIA TVPEVLTVFG       600
     KVGRAETATD PAPLTMIETF IQLKPKDQWR EGMTLDKLKK ELDSLVKFPG VTNAWVMPIK       660
     TRIDMLATGI KTPVGIKVAG PKLSEIQKIG QQIESILKDV PGTASVYSER VAGGRYIKVD       720
     INREKAARYS LNIADIQQVV ATAIGGTNVT QTVEGQERYP VNLRYPQGYR DSPEELMLLP       780
     IVTPAGQRIA LADVAKVFIE DGPAGIKSEN ARLNGWSFID IENIDIGTYV ENAQQILHEQ       840
     LILPAGYSIT WAGQYEYMQR AKDKLAYVLP LTLAIIVVLL YLNFRSFAEV LIIIVTLPLA       900
     MIGGIWLMYL EGFNFSVAVG VGFIALAGVA VEIGVIMLVY LNQAYQEKIT QAQQTGVPLN       960
     YEQLKQAITE GAGLRVRPVM MTVATIVIGL LPVLYGTGTG SEIMSRIAAP MVGGMFSAVV      1020
     LTLLVIPATY LLWRKRDL                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page