(data stored in ACNUC7421 zone)

EMBL: CR954246.CUTA

CR954246.CUTA        Location/Qualifiers
FT   CDS             275506..275826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="PSHAa0262"
FT                   /product="periplasmic divalent cation tolerance protein
FT                   (C-type cytochrome biogenesis protein)"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7623666"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0262"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85361"
FT                   /db_xref="GOA:Q3IDT4"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT4"
FT                   /protein_id="CAI85361.1"
FT                   /translation="MAAQFKLIFTTCKDENEARELAKALVERKLAACVNILPKVASIYI
FT                   WEGEVVEATEAKLLIKTKLDKMNDVFLTIKALHSYEVPEIQVVDVATGNLAYFNWMDEV
FT                   LN"
     MAAQFKLIFT TCKDENEARE LAKALVERKL AACVNILPKV ASIYIWEGEV VEATEAKLLI        60
     KTKLDKMNDV FLTIKALHSY EVPEIQVVDV ATGNLAYFNW MDEVLN                      106
//

If you have problems or comments...

PBIL Back to PBIL home page