(data stored in ACNUC7421 zone)

EMBL: CR954246.CYAY

CR954246.CYAY        Location/Qualifiers
FT   CDS             97340..97663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="PSHAa0095"
FT                   /product="putative CyaY, involved in iron scavenging and/or
FT                   transfer to heme"
FT                   /function="2.5.12 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 7567469, 8874804, 10908679, 14653404;
FT                   Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85204"
FT                   /db_xref="GOA:Q3IEW0"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEW0"
FT                   /protein_id="CAI85204.1"
FT                   /translation="MTDHEYHQLAEALMFTIEEQVDDCEADLDYESAQGILELIFPDNS
FT                   KIVINKQAPLHQVWVATKFNGHHFELRGDKWIDNRSGAEFWQFINEASTRQAGQDVKWQ
FT                   SSL"
     MTDHEYHQLA EALMFTIEEQ VDDCEADLDY ESAQGILELI FPDNSKIVIN KQAPLHQVWV        60
     ATKFNGHHFE LRGDKWIDNR SGAEFWQFIN EASTRQAGQD VKWQSSL                     107
//

If you have problems or comments...

PBIL Back to PBIL home page