(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSC

CR954246.CYSC        Location/Qualifiers
FT   CDS             complement(216452..217045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="PSHAa0209"
FT                   /product="adenosine 5'-phosphosulfate kinase"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.7.1.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9515915, 10939241, 12072441; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85312"
FT                   /db_xref="GOA:Q3ILQ1"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ1"
FT                   /protein_id="CAI85312.1"
FT                   /translation="MDENIVWHNYATTKAQRSEQKKHQSAIIWFTGFSGSGKSTVANAL
FT                   EAALNQQGIHTYLLDGDNVRHGLCKDLGFSDADRVENIRRVGETAKLMVDAGLLVLTAF
FT                   ISPFRAERDMVRSLVDDKEFIEVFIDTPLDVCESRDPKGLYKKARAGEIKHFTGIDSSY
FT                   EIPINPEIILDTSKNTLDQSVVQLITYLKQQHII"
     MDENIVWHNY ATTKAQRSEQ KKHQSAIIWF TGFSGSGKST VANALEAALN QQGIHTYLLD        60
     GDNVRHGLCK DLGFSDADRV ENIRRVGETA KLMVDAGLLV LTAFISPFRA ERDMVRSLVD       120
     DKEFIEVFID TPLDVCESRD PKGLYKKARA GEIKHFTGID SSYEIPINPE IILDTSKNTL       180
     DQSVVQLITY LKQQHII                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page