(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSD

CR954246.CYSD        Location/Qualifiers
FT   CDS             complement(220260..221159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="PSHAa0212"
FT                   /product="ATP-sulfurylase, subunit 2 (ATP:sulfate
FT                   adenylyltransferase)"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.7.7.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2828368, 7487067, 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85315"
FT                   /db_xref="GOA:Q3ILR0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILR0"
FT                   /protein_id="CAI85315.1"
FT                   /translation="MALTHLQQLEAESIKIMREVAAEFENPVMLYSIGKDSSVLLHLAR
FT                   KAFYPAKIPFPLLHVDTNWKFSEMIEFRDRIAKEYGFELLVHKNPEGMEIGISPFEHGS
FT                   GKHTDIMKTQGLKQALDKYGFDAAFGGARRDEEKSRAKERVYSFRDKHHRWDPKNQRPE
FT                   LWNTYNSQVNPGESIRVFPLSNWTELDIWQYIYQENIDMVPLYLAKERPVVDRDGTLIM
FT                   VDDERMPLLEGEVPMMKSVRFRTLGCYPLTGAVESTASSLTEIIEEMLLSTSSEREGRV
FT                   IDHDSAGSMEKKKREGYF"
     MALTHLQQLE AESIKIMREV AAEFENPVML YSIGKDSSVL LHLARKAFYP AKIPFPLLHV        60
     DTNWKFSEMI EFRDRIAKEY GFELLVHKNP EGMEIGISPF EHGSGKHTDI MKTQGLKQAL       120
     DKYGFDAAFG GARRDEEKSR AKERVYSFRD KHHRWDPKNQ RPELWNTYNS QVNPGESIRV       180
     FPLSNWTELD IWQYIYQENI DMVPLYLAKE RPVVDRDGTL IMVDDERMPL LEGEVPMMKS       240
     VRFRTLGCYP LTGAVESTAS SLTEIIEEML LSTSSEREGR VIDHDSAGSM EKKKREGYF        299
//

If you have problems or comments...

PBIL Back to PBIL home page