(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSG

CR954246.CYSG        Location/Qualifiers
FT   CDS             complement(221215..222636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysG"
FT                   /locus_tag="PSHAa0213"
FT                   /product="multifunctional siroheme synthase:
FT                   uroporphyrinogen methyltransferase; 1,
FT                   3-dimethyluroporphyriongen III dehydrogenase; siroheme
FT                   ferrochelatase"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.1.1.107"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2550423, 8243665, 7592323, 9150215, 10939241, 11114933;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85316"
FT                   /db_xref="GOA:Q3ILQ9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILQ9"
FT                   /protein_id="CAI85316.1"
FT                   /translation="MQYLPIFTKLDNKPVLVVGGGDVALRKCSALLKARASITLVAPKF
FT                   CQQLIELASENKVTLIHEYFSEQHLKNMMLVIAATDLEHVNSQVFELANAHNIFVNVVD
FT                   DQPKCTFIFPSIVDRNPITIAISSAGTAPVLARRLREKLETLIPQHIGPLATLVGGFRS
FT                   KVKQRFKHFADRRQFWEGVFDSSVVSKVQTGDTQAAEQQLEHMLNAKAEPEGEVYVVGA
FT                   GPGDPELLTLKALQLMQQADVVVYDYLVSDEIMELVRRDADLICVGKRLGDHSVAQQDT
FT                   NQMLVDLAKQGKKVCRIKGGDPFIYGRGGEEVQVLAANKVNYQIVPGITAAAGCSAYAG
FT                   IPLTHRDHAQAIQFVTGHCKKDGQELDWQSLAKPNQTLAIYMGVIKSPHIQAELLKHGR
FT                   NANTPVAIIENGTRKNQRVITGKLGELADLITRNSVVSPALLIIGEVASLHQELHWFGA
FT                   KAQTSSFAQPLTDVA"
     MQYLPIFTKL DNKPVLVVGG GDVALRKCSA LLKARASITL VAPKFCQQLI ELASENKVTL        60
     IHEYFSEQHL KNMMLVIAAT DLEHVNSQVF ELANAHNIFV NVVDDQPKCT FIFPSIVDRN       120
     PITIAISSAG TAPVLARRLR EKLETLIPQH IGPLATLVGG FRSKVKQRFK HFADRRQFWE       180
     GVFDSSVVSK VQTGDTQAAE QQLEHMLNAK AEPEGEVYVV GAGPGDPELL TLKALQLMQQ       240
     ADVVVYDYLV SDEIMELVRR DADLICVGKR LGDHSVAQQD TNQMLVDLAK QGKKVCRIKG       300
     GDPFIYGRGG EEVQVLAANK VNYQIVPGIT AAAGCSAYAG IPLTHRDHAQ AIQFVTGHCK       360
     KDGQELDWQS LAKPNQTLAI YMGVIKSPHI QAELLKHGRN ANTPVAIIEN GTRKNQRVIT       420
     GKLGELADLI TRNSVVSPAL LIIGEVASLH QELHWFGAKA QTSSFAQPLT DVA              473
//

If you have problems or comments...

PBIL Back to PBIL home page