(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSH

CR954246.CYSH        Location/Qualifiers
FT   CDS             165235..165975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="PSHAa0156"
FT                   /product="3'-phosphoadenosine 5'-phosphosulfate (PAPS)
FT                   reductase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.2.1.5 : Serine family"
FT                   /EC_number="1.8.4.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85260"
FT                   /db_xref="GOA:Q3IFM0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011800"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFM0"
FT                   /protein_id="CAI85260.1"
FT                   /translation="MSEFKNILQLDKQSQTSMLADANGILKNMSAEQRVQWALENLPET
FT                   HFLSSSFGIQAAVMLHLITLQQPDIPVVLTDTGYLFPQTYQFIEQMTARLSLNLKVYKS
FT                   ELSPAWQEAKFGKLWEQGEAGIKQYNQLNKVEPMTRALKEINAGTWFSGLRRDQASSRA
FT                   DKQVIEISRGTVKVYPIIEWTNRDVYQYLTKHNLPYHPLWEEGYVSMGDIHTTRKLEPG
FT                   MTEEETRFFGLNRECGLHIDGDGI"
     MSEFKNILQL DKQSQTSMLA DANGILKNMS AEQRVQWALE NLPETHFLSS SFGIQAAVML        60
     HLITLQQPDI PVVLTDTGYL FPQTYQFIEQ MTARLSLNLK VYKSELSPAW QEAKFGKLWE       120
     QGEAGIKQYN QLNKVEPMTR ALKEINAGTW FSGLRRDQAS SRADKQVIEI SRGTVKVYPI       180
     IEWTNRDVYQ YLTKHNLPYH PLWEEGYVSM GDIHTTRKLE PGMTEEETRF FGLNRECGLH       240
     IDGDGI                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page