(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSI

CR954246.CYSI        Location/Qualifiers
FT   CDS             163494..165191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="PSHAa0155"
FT                   /product="sulfite reductase, beta subunit, NADPH-dependent
FT                   hemoprotein"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.2.1.5 : Serine family"
FT                   /EC_number="1.8.7.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85259"
FT                   /db_xref="GOA:Q3IFM1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFM1"
FT                   /protein_id="CAI85259.1"
FT                   /translation="MSEQDKNVKLSDNERMKRESNFLRGTIATDLKDEITGGFTADNFQ
FT                   LIRFHGMYQQDDRDIRGERAKQKLEPLHNVMLRARMPGGIIKPEQWLAIDKFAEEKTSY
FT                   GSIRLTTRQTFQFHGVLKPNIKGMHQLLDSVGIDSIATAGDVNRNVLCTTNPVESELHQ
FT                   EAYEWAAKISEHLLPKTKAYAEIWLNGEKAETTEEPILGSNYLPRKFKTTVTIPPNNEV
FT                   DVHANDLNFVAIAENGKLIGFNVLVGGGLAMTHGDTATYPRKADDFGFIPLEHTLKIAE
FT                   HVVSVQRDWGNRSNRKNAKTKYTLDRVGVDVFKAEVEKRAGVEFASSRPYKFTHRGDRI
FT                   GWVEGIDGKHHLTLFIQSGRILDYPDKPLKTGCRKIAEVHQGDMRMTANQNLIIAGVAA
FT                   NQKAVIEEIARNHGLIDDKDTEQRKNSMACVALPTCPLAMAEAERYLPSLVEKIEALLA
FT                   KHGVPNDSIIMRVVGCPNGCGRAMLAEAGLVGKGPGKYNVYLGGNLEGTRIPKLYLENV
FT                   GEDVYLAAFDELIGQWVNERNDGECFGDFVIRKGIVAEVKVSVTDFHA"
     MSEQDKNVKL SDNERMKRES NFLRGTIATD LKDEITGGFT ADNFQLIRFH GMYQQDDRDI        60
     RGERAKQKLE PLHNVMLRAR MPGGIIKPEQ WLAIDKFAEE KTSYGSIRLT TRQTFQFHGV       120
     LKPNIKGMHQ LLDSVGIDSI ATAGDVNRNV LCTTNPVESE LHQEAYEWAA KISEHLLPKT       180
     KAYAEIWLNG EKAETTEEPI LGSNYLPRKF KTTVTIPPNN EVDVHANDLN FVAIAENGKL       240
     IGFNVLVGGG LAMTHGDTAT YPRKADDFGF IPLEHTLKIA EHVVSVQRDW GNRSNRKNAK       300
     TKYTLDRVGV DVFKAEVEKR AGVEFASSRP YKFTHRGDRI GWVEGIDGKH HLTLFIQSGR       360
     ILDYPDKPLK TGCRKIAEVH QGDMRMTANQ NLIIAGVAAN QKAVIEEIAR NHGLIDDKDT       420
     EQRKNSMACV ALPTCPLAMA EAERYLPSLV EKIEALLAKH GVPNDSIIMR VVGCPNGCGR       480
     AMLAEAGLVG KGPGKYNVYL GGNLEGTRIP KLYLENVGED VYLAAFDELI GQWVNERNDG       540
     ECFGDFVIRK GIVAEVKVSV TDFHA                                             565
//

If you have problems or comments...

PBIL Back to PBIL home page