(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSJ

CR954246.CYSJ        Location/Qualifiers
FT   CDS             161631..163445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysJ"
FT                   /locus_tag="PSHAa0154"
FT                   /product="sulfite reductase, alpha subunit (flavoprotein)"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.2.1.5 : Serine family"
FT                   /EC_number="1.6.2.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85258"
FT                   /db_xref="GOA:Q3IFM2"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFM2"
FT                   /protein_id="CAI85258.1"
FT                   /translation="MLLGQLNAAASPLSQEQVQKLQGLVAELNPIQQAWVSGYLAANAN
FT                   TAALGGAVGAAPSAGEAVALTILYGSQTGNAKGVAAKLKAQAESRGLAVKLVSMADYKP
FT                   TALKKEKFITVVVATYGEGEPPEDAEALHEFLTTKKAPKLDGVKVAVIGLGDSSYEFFC
FT                   QTAKDFEQRLNTLGAETIYQRADLDVDYEDEATTWITGALDAFEPDLKAQQGSSGGQVI
FT                   AMPFAGSTTVASQYTKQNPFAAELGLVQKITGRDSTKDVRHVEISLEGSDISYIPGDSL
FT                   GVYFLNDEARVDELLTHTQIDAASLVKVADEQLSIRDALIEKLELTQSYPGFVEKYAIA
FT                   TGTPQLLKLVEDKAAMHQYIEPRQIFDVVAQNPAKLDAQTLVDCLRKLQARLYSIASSQ
FT                   SEVEDEVHLTVALVEFDAFGREHLGGCSGYLARRAEEGCKVKVFSEHNDNFRLPTNDET
FT                   PIIMVGPGTGIAPFRAFLQERDARGASGKNWLFFGNPHFTQDFLYQVEIQGYLKSGLLS
FT                   KVDVAFSRDQAEKVYVQDKLRSNSKAIFEWLEAGAHFYVCGDANNMAKDVHQTLLEIIK
FT                   ENTGKSDEDAQQYLKDLRSANRYQKDVY"
     MLLGQLNAAA SPLSQEQVQK LQGLVAELNP IQQAWVSGYL AANANTAALG GAVGAAPSAG        60
     EAVALTILYG SQTGNAKGVA AKLKAQAESR GLAVKLVSMA DYKPTALKKE KFITVVVATY       120
     GEGEPPEDAE ALHEFLTTKK APKLDGVKVA VIGLGDSSYE FFCQTAKDFE QRLNTLGAET       180
     IYQRADLDVD YEDEATTWIT GALDAFEPDL KAQQGSSGGQ VIAMPFAGST TVASQYTKQN       240
     PFAAELGLVQ KITGRDSTKD VRHVEISLEG SDISYIPGDS LGVYFLNDEA RVDELLTHTQ       300
     IDAASLVKVA DEQLSIRDAL IEKLELTQSY PGFVEKYAIA TGTPQLLKLV EDKAAMHQYI       360
     EPRQIFDVVA QNPAKLDAQT LVDCLRKLQA RLYSIASSQS EVEDEVHLTV ALVEFDAFGR       420
     EHLGGCSGYL ARRAEEGCKV KVFSEHNDNF RLPTNDETPI IMVGPGTGIA PFRAFLQERD       480
     ARGASGKNWL FFGNPHFTQD FLYQVEIQGY LKSGLLSKVD VAFSRDQAEK VYVQDKLRSN       540
     SKAIFEWLEA GAHFYVCGDA NNMAKDVHQT LLEIIKENTG KSDEDAQQYL KDLRSANRYQ       600
     KDVY                                                                    604
//

If you have problems or comments...

PBIL Back to PBIL home page