(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSN

CR954246.CYSN        Location/Qualifiers
FT   CDS             complement(218836..220260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /locus_tag="PSHAa0211"
FT                   /product="ATP-sulfurylase, subunit 1 (ATP:sulfate
FT                   adenylyltransferase)"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="2.7.7.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1730615, 7487067, 10939241, 12007424; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85314"
FT                   /db_xref="GOA:Q3ILR1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR1"
FT                   /protein_id="CAI85314.1"
FT                   /translation="MANQNNDTFNEVKAIGIDAYLARQQDKSLLRMLTCGSVDDGKSTL
FT                   IGRLLHDSHQIYEDQLAALHKDNEKVGNAGDDLDLALLVDGLQAEREQGITIDVAYRYF
FT                   STAKRKFIIADTPGHEQYTRNMVTGASTSDVAIILVDARYGVQVQTKRHSFICDSLGIK
FT                   QFVVAINKMDIVDFDETVYEKIKADYLKFAEQLNVSNIKFVPMSALKGDNVVTRSVHTP
FT                   YYTDKPLLELLEDSPAAQIDTDFEARLPVQYVARPNLNFRGFQGTLASGKLQVGDAIKV
FT                   LPSGKTSSIKEIVTFDGNLDSAQAGQAITVTLNSEIDISRGDVIVPASSTAIVTNQLQA
FT                   KLVWMHETPLQLGKSYNFKLGSKNTSAQVTKIDHTIDVNTLEHGSSDTLQLNEIAIVTL
FT                   ELSETILADEYHSNHETGSFILIDRLSNLTIAAGMIEQVLQSQAQQSNFSAFEVEFNTL
FT                   VRKHFPHWQALDISKL"
     MANQNNDTFN EVKAIGIDAY LARQQDKSLL RMLTCGSVDD GKSTLIGRLL HDSHQIYEDQ        60
     LAALHKDNEK VGNAGDDLDL ALLVDGLQAE REQGITIDVA YRYFSTAKRK FIIADTPGHE       120
     QYTRNMVTGA STSDVAIILV DARYGVQVQT KRHSFICDSL GIKQFVVAIN KMDIVDFDET       180
     VYEKIKADYL KFAEQLNVSN IKFVPMSALK GDNVVTRSVH TPYYTDKPLL ELLEDSPAAQ       240
     IDTDFEARLP VQYVARPNLN FRGFQGTLAS GKLQVGDAIK VLPSGKTSSI KEIVTFDGNL       300
     DSAQAGQAIT VTLNSEIDIS RGDVIVPASS TAIVTNQLQA KLVWMHETPL QLGKSYNFKL       360
     GSKNTSAQVT KIDHTIDVNT LEHGSSDTLQ LNEIAIVTLE LSETILADEY HSNHETGSFI       420
     LIDRLSNLTI AAGMIEQVLQ SQAQQSNFSA FEVEFNTLVR KHFPHWQALD ISKL             474
//

If you have problems or comments...

PBIL Back to PBIL home page