(data stored in ACNUC7421 zone)

EMBL: CR954246.CYSQ

CR954246.CYSQ        Location/Qualifiers
FT   CDS             complement(215671..216378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysQ"
FT                   /locus_tag="PSHAa0208"
FT                   /product="likely to be PAP (3',5' adenosine diphosphate) 3'
FT                   phosphatase"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /function="2.5.6 : Pantothenate and coenzyme A"
FT                   /function="2.2.1.5 : Serine family"
FT                   /function="2.4 : Metabolism of lipids"
FT                   /EC_number="3.1.3.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85311"
FT                   /db_xref="GOA:Q3ILR4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR4"
FT                   /protein_id="CAI85311.1"
FT                   /translation="MGIYQKDFNVEYKADESPVTDADLAAHKIIVAGLQQLTPDIPILS
FT                   EENADISWEVRKAWKSYWLVDPIDGTKEFIKKNGEFTVNIALIENGIPVLAVVDAPALG
FT                   VSYLASEAIGAFKDKGDERIELKVTTKPNTGLIRVVGSRSHPSPDLAEFVKRFDEVEMV
FT                   SKGSSLKLCLVAEGSADIYPRLGPTCEWDTGAGHAIAAIAGAKVTKIDGSPLIYNTKDE
FT                   YLNPYFIVSAIEE"
     MGIYQKDFNV EYKADESPVT DADLAAHKII VAGLQQLTPD IPILSEENAD ISWEVRKAWK        60
     SYWLVDPIDG TKEFIKKNGE FTVNIALIEN GIPVLAVVDA PALGVSYLAS EAIGAFKDKG       120
     DERIELKVTT KPNTGLIRVV GSRSHPSPDL AEFVKRFDEV EMVSKGSSLK LCLVAEGSAD       180
     IYPRLGPTCE WDTGAGHAIA AIAGAKVTKI DGSPLIYNTK DEYLNPYFIV SAIEE            235
//

If you have problems or comments...

PBIL Back to PBIL home page