(data stored in ACNUC7421 zone)

EMBL: CR954246.CZCA

CR954246.CZCA        Location/Qualifiers
FT   CDS             598495..601632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="PSHAa0579"
FT                   /product="Cobalt-zinc-cadmium resistance protein czcA
FT                   (Cation efflux system protein czcA)"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85666"
FT                   /db_xref="GOA:Q3ILG7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG7"
FT                   /protein_id="CAI85666.1"
FT                   /translation="MINWIVSFAVKRRMLVLALTFLFAGFGVYNIQNLAVDAVPDITNV
FT                   QVQINTKAQGFTPLEVEQRITYLVETAMAGIPKLDYTRSLSRYGLSQVTVIFDEGTDIY
FT                   WARQQIGERIQSIRSDLPANIEPNLGPIASGLGEIFTYSVHTEPNTLKDDGTPYNAEDL
FT                   RTLQDWVIRPQLLKVKGVTEINSQGGFERQYQVAPVPEKLIAYKLTISDVISALEVNNS
FT                   NRGAGYIERFDGQYLVRSPGQLKTLEDIANTVVAKRDDAPVRIKDVANVLLGKELRTGA
FT                   ATYNGEETVLGTAMMLIGENSRVVAKAMADKLVDVQKSLPAGVIVEAVYDRTTLVDKTI
FT                   ATVQTNLFEGAVLVIVVLLLLLGNVTGALITAMVIPLSMLFAVTGMVGNRVSGNLMSLG
FT                   AIDFGLIVDGAVIVVENCLRQLGVAQHKHGRLLTLNERLNVVTAATKEVFTPAVFGIVI
FT                   IMLVYLPLFALSGVEGKMFQPMAFTVVAALIGALIFGVTFVPAAIAVFVRGKVNETENA
FT                   VMRGVKKVYKPLLGISLKLPWLMVGIATALVLVLGFKVKNMGAEFLPQLDEGDIAMHAL
FT                   RITGTGIEQSVQMQKELEQAILKQPEVANVFSKIGTADVASDPMPPNVADTFLMLKPQK
FT                   QWPNPALTKEELVQQIRTRVNDVPGNNYEFTQPIEMRFNELIAGVRADVALRIYGDDLS
FT                   VLKEFGEKATGLMRNIAGATDVRLEQMEGLPTLSVTPMRDHMALLGLSVNDIQQTLAAA
FT                   VGGVQTGLIFEGDKRFSLLVRLDKRWSSDVSALARLPVALPKDSNPELAFVPLGEVATI
FT                   SIEKGPNQINRESGKRNVVVTANVEGRDLASFVSDAQASMNESLNLPSGYWLEYGGTFE
FT                   QLQSASKRLSLVVPVTLLLIFGLLYSAFGSLRDSLIIFSGVPLALTGGVLALLLRDMPL
FT                   SISAGVGFIALSGVAVLNGVVMLSFIKQLRDDGLNLIDAINDGALQRLRPVLMTALVAS
FT                   LGFIPMALNSGTGSEVQKPLATVVVGGIISSTLLTLLILPALYKLVHAKFNKYQAA"
     MINWIVSFAV KRRMLVLALT FLFAGFGVYN IQNLAVDAVP DITNVQVQIN TKAQGFTPLE        60
     VEQRITYLVE TAMAGIPKLD YTRSLSRYGL SQVTVIFDEG TDIYWARQQI GERIQSIRSD       120
     LPANIEPNLG PIASGLGEIF TYSVHTEPNT LKDDGTPYNA EDLRTLQDWV IRPQLLKVKG       180
     VTEINSQGGF ERQYQVAPVP EKLIAYKLTI SDVISALEVN NSNRGAGYIE RFDGQYLVRS       240
     PGQLKTLEDI ANTVVAKRDD APVRIKDVAN VLLGKELRTG AATYNGEETV LGTAMMLIGE       300
     NSRVVAKAMA DKLVDVQKSL PAGVIVEAVY DRTTLVDKTI ATVQTNLFEG AVLVIVVLLL       360
     LLGNVTGALI TAMVIPLSML FAVTGMVGNR VSGNLMSLGA IDFGLIVDGA VIVVENCLRQ       420
     LGVAQHKHGR LLTLNERLNV VTAATKEVFT PAVFGIVIIM LVYLPLFALS GVEGKMFQPM       480
     AFTVVAALIG ALIFGVTFVP AAIAVFVRGK VNETENAVMR GVKKVYKPLL GISLKLPWLM       540
     VGIATALVLV LGFKVKNMGA EFLPQLDEGD IAMHALRITG TGIEQSVQMQ KELEQAILKQ       600
     PEVANVFSKI GTADVASDPM PPNVADTFLM LKPQKQWPNP ALTKEELVQQ IRTRVNDVPG       660
     NNYEFTQPIE MRFNELIAGV RADVALRIYG DDLSVLKEFG EKATGLMRNI AGATDVRLEQ       720
     MEGLPTLSVT PMRDHMALLG LSVNDIQQTL AAAVGGVQTG LIFEGDKRFS LLVRLDKRWS       780
     SDVSALARLP VALPKDSNPE LAFVPLGEVA TISIEKGPNQ INRESGKRNV VVTANVEGRD       840
     LASFVSDAQA SMNESLNLPS GYWLEYGGTF EQLQSASKRL SLVVPVTLLL IFGLLYSAFG       900
     SLRDSLIIFS GVPLALTGGV LALLLRDMPL SISAGVGFIA LSGVAVLNGV VMLSFIKQLR       960
     DDGLNLIDAI NDGALQRLRP VLMTALVASL GFIPMALNSG TGSEVQKPLA TVVVGGIISS      1020
     TLLTLLILPA LYKLVHAKFN KYQAA                                            1045
//

If you have problems or comments...

PBIL Back to PBIL home page