(data stored in ACNUC7421 zone)

EMBL: CR954246.CZCB

CR954246.CZCB        Location/Qualifiers
FT   CDS             597239..598486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="PSHAa0578"
FT                   /product="putative Cobalt-zinc-cadmium resistance protein ;
FT                   (cation efflux system protein)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85665"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILG8"
FT                   /protein_id="CAI85665.1"
FT                   /translation="MNKNIIALLVSLSLAGSVLSTDVFASAEHGESGHKETEQHEQKQG
FT                   PHGGFLLVDPKLTLELKLQEFAGDVELRIYAYKQSKPINISDLNITMSLKRLVEAPQNI
FT                   QFAAEGDYLVSTQSINEPHSFVLAVTANYNGESISYEYEQHEGRTTLTERAIERAGIKT
FT                   EIAQSGEVDITDTLFGVIAPTQHGTVEVMAPYTGLISDIFVSIGQSVKKGEALVSITNR
FT                   ETLQNYTIKSPISGVVTEQYLKRGELASTSALMQVVNLDKVWVELSAFPENIEKLAIGQ
FT                   SAKVYDLHHHLNTQGKVFFIAPMMTGGHIARARIELNNPDGHWRPGMHINSDVSVAKIN
FT                   ASVRVKPHAIQEFNGQTSVFVRKNNVFEVRPVTLGAKNSEWVEVLTGLNAGSEYVTDNS
FT                   YVIKADILKSGASHAH"
     MNKNIIALLV SLSLAGSVLS TDVFASAEHG ESGHKETEQH EQKQGPHGGF LLVDPKLTLE        60
     LKLQEFAGDV ELRIYAYKQS KPINISDLNI TMSLKRLVEA PQNIQFAAEG DYLVSTQSIN       120
     EPHSFVLAVT ANYNGESISY EYEQHEGRTT LTERAIERAG IKTEIAQSGE VDITDTLFGV       180
     IAPTQHGTVE VMAPYTGLIS DIFVSIGQSV KKGEALVSIT NRETLQNYTI KSPISGVVTE       240
     QYLKRGELAS TSALMQVVNL DKVWVELSAF PENIEKLAIG QSAKVYDLHH HLNTQGKVFF       300
     IAPMMTGGHI ARARIELNNP DGHWRPGMHI NSDVSVAKIN ASVRVKPHAI QEFNGQTSVF       360
     VRKNNVFEVR PVTLGAKNSE WVEVLTGLNA GSEYVTDNSY VIKADILKSG ASHAH            415
//

If you have problems or comments...

PBIL Back to PBIL home page