(data stored in ACNUC7421 zone)

EMBL: CR954246.DAPA

CR954246.DAPA        Location/Qualifiers
FT   CDS             complement(188207..189091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="PSHAa0180"
FT                   /product="putative dihydrodipicolinate synthase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="4.2.1.52"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8021219; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85283"
FT                   /db_xref="GOA:Q3IJ34"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ34"
FT                   /protein_id="CAI85283.1"
FT                   /translation="MIKNFNLDDYSVWTALVTPFNQNGTIDYGTLTTLVAEQAAANNAI
FT                   LLLGSTGEGLALTLKEQQAIVEHVCQLSPNVPLMVAVGGMNLKQQLAWVEYCNHLPIHS
FT                   FLLGSPLYAKPGVIGQTHWFESLLNISKHPCMLYNVPGRSAVDIPVATIQNLQQHKNLW
FT                   ALKEASGNIAQFEAYRQAAPNLAIFSGDDALMPYFAQAGAKGLVSVAANAWPLQTHEFV
FT                   QRSLSGQYPNLFTQWSSAISSLFTVANPIPVKVLMHLQGRLTSSYLRPPLTHLELTQTT
FT                   CIEQANNTILSWH"
     MIKNFNLDDY SVWTALVTPF NQNGTIDYGT LTTLVAEQAA ANNAILLLGS TGEGLALTLK        60
     EQQAIVEHVC QLSPNVPLMV AVGGMNLKQQ LAWVEYCNHL PIHSFLLGSP LYAKPGVIGQ       120
     THWFESLLNI SKHPCMLYNV PGRSAVDIPV ATIQNLQQHK NLWALKEASG NIAQFEAYRQ       180
     AAPNLAIFSG DDALMPYFAQ AGAKGLVSVA ANAWPLQTHE FVQRSLSGQY PNLFTQWSSA       240
     ISSLFTVANP IPVKVLMHLQ GRLTSSYLRP PLTHLELTQT TCIEQANNTI LSWH             294
//

If you have problems or comments...

PBIL Back to PBIL home page