(data stored in ACNUC7421 zone)

EMBL: CR954246.DAPD

CR954246.DAPD        Location/Qualifiers
FT   CDS             complement(187451..188191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="PSHAa0179"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="2.3.1.117"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 6094577, 2537822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85282"
FT                   /db_xref="GOA:Q3IJ35"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ35"
FT                   /protein_id="CAI85282.1"
FT                   /translation="MSWLELLNNLESGAVRAASQNESGQWQANVAVKQGILEAFKNGTN
FT                   TEFVGGFVDKHNLAPQQFSATDGVRMVPGGSSVRRGAYVAKGTIIMPPAYVNIGAYIDE
FT                   GTMVDSHALVGSCAQVGKNVHLSAAVQLGGVLEPIGASPVVVEDDAFIGAGCVIVEGVV
FT                   IKKGAVLAPGVRLSATIPVYDCVNERQLDKGEPIPEYAIVIPGSRPASNEWARAQGLSM
FT                   SCALIVKYRDEQSDASLLLEEVLR"
     MSWLELLNNL ESGAVRAASQ NESGQWQANV AVKQGILEAF KNGTNTEFVG GFVDKHNLAP        60
     QQFSATDGVR MVPGGSSVRR GAYVAKGTII MPPAYVNIGA YIDEGTMVDS HALVGSCAQV       120
     GKNVHLSAAV QLGGVLEPIG ASPVVVEDDA FIGAGCVIVE GVVIKKGAVL APGVRLSATI       180
     PVYDCVNERQ LDKGEPIPEY AIVIPGSRPA SNEWARAQGL SMSCALIVKY RDEQSDASLL       240
     LEEVLR                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page