(data stored in ACNUC7421 zone)

EMBL: CR954246.DAPF

CR954246.DAPF        Location/Qualifiers
FT   CDS             complement(94850..95680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="PSHAa0092"
FT                   /product="diaminopimelate epimerase"
FT                   /function="1.1.1 : Biosynthesis of murein sacculus and
FT                   peptidoglycan"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="5.1.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3283102, 3031013; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85201"
FT                   /db_xref="GOA:Q3IEW3"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IEW3"
FT                   /protein_id="CAI85201.1"
FT                   /translation="MLVNFSKMHGLGNDFVVIDNITQNVFLSRDQIIKLADRHFGIGFD
FT                   QLLMVEAPYSPDLDFHYRIFNADGTEVEQCGNGARCFARFVRMKGLTNKHKITVSTKSG
FT                   NLTLYIEKDGQVTVNMGHPNFEPSKIPLKATKRELTYIIRTEEHTVFSGAVSMGNPHCV
FT                   LEVDDITTAQVDILGPLLENHERFPQRANIGFMQVISKEHIKLRVWERGVNETLACGTG
FT                   ACAAMVIGFIQNKLISTVQVDLPGGSLQIRWNGEGHPVRMTGPAEHVFDGQVAL"
     MLVNFSKMHG LGNDFVVIDN ITQNVFLSRD QIIKLADRHF GIGFDQLLMV EAPYSPDLDF        60
     HYRIFNADGT EVEQCGNGAR CFARFVRMKG LTNKHKITVS TKSGNLTLYI EKDGQVTVNM       120
     GHPNFEPSKI PLKATKRELT YIIRTEEHTV FSGAVSMGNP HCVLEVDDIT TAQVDILGPL       180
     LENHERFPQR ANIGFMQVIS KEHIKLRVWE RGVNETLACG TGACAAMVIG FIQNKLISTV       240
     QVDLPGGSLQ IRWNGEGHPV RMTGPAEHVF DGQVAL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page