(data stored in ACNUC7421 zone)

EMBL: CR954246.DBPA

CR954246.DBPA        Location/Qualifiers
FT   CDS             113841..115229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dbpA"
FT                   /locus_tag="PSHAa0109"
FT                   /product="putative ATP-dependent RNA helicase; putative
FT                   cold-shock protein; could be specific for rRNA folding"
FT                   /function="3.2.2 : Processing and degradation of RNA"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12460566; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85218"
FT                   /db_xref="GOA:Q3IDJ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ4"
FT                   /protein_id="CAI85218.1"
FT                   /translation="MTTTAFSSLALPSGLVDNLSTLGYTHMTPVQAQSLPPVLAGKDII
FT                   AQAKTGSGKTAAFSLGVLAKLNVKRFRIQSLVLCPTRELAEQVAVEMRKLARGIHNIKI
FT                   LTLCGGVSIGPQIGSLEHGAHIIVGTPGRVDDHIRKGTLRLDDVETLVLDEADQMLDMG
FT                   FQDTLDAIIERIPTNRQTLLFSATFPRAIEAVAKRVLSNPVMVKVEEEQAKSTIKQYFY
FT                   KMDNNKQRYPTLKLLLLKFTPQSCVVFCNTKVETQQLCDDLVDEGFSAVSLHGDLEQRD
FT                   RERTLIHFSNKSASILVATDVAARGLDIDDMDMVINYHLAHDTQTHVHRIGRTGRAGKK
FT                   GIACSIYGEAEAFKIAQIGDHYERDVIPEPMPSFSLLEKPPYKPEMVTLMLDSGKKQKV
FT                   RAGDILGALTGKDGIAGRQVGKINVLDNVAFVAVERNSSKPALRKLTEGNIKGRKIRAR
FT                   RLTC"
     MTTTAFSSLA LPSGLVDNLS TLGYTHMTPV QAQSLPPVLA GKDIIAQAKT GSGKTAAFSL        60
     GVLAKLNVKR FRIQSLVLCP TRELAEQVAV EMRKLARGIH NIKILTLCGG VSIGPQIGSL       120
     EHGAHIIVGT PGRVDDHIRK GTLRLDDVET LVLDEADQML DMGFQDTLDA IIERIPTNRQ       180
     TLLFSATFPR AIEAVAKRVL SNPVMVKVEE EQAKSTIKQY FYKMDNNKQR YPTLKLLLLK       240
     FTPQSCVVFC NTKVETQQLC DDLVDEGFSA VSLHGDLEQR DRERTLIHFS NKSASILVAT       300
     DVAARGLDID DMDMVINYHL AHDTQTHVHR IGRTGRAGKK GIACSIYGEA EAFKIAQIGD       360
     HYERDVIPEP MPSFSLLEKP PYKPEMVTLM LDSGKKQKVR AGDILGALTG KDGIAGRQVG       420
     KINVLDNVAF VAVERNSSKP ALRKLTEGNI KGRKIRARRL TC                          462
//

If you have problems or comments...

PBIL Back to PBIL home page