(data stored in ACNUC7421 zone)

EMBL: CR954246.DCDA

CR954246.DCDA        Location/Qualifiers
FT   CDS             complement(186246..187451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcdA"
FT                   /locus_tag="PSHAa0178"
FT                   /product="diaminopimelate decarboxylase, PLP-binding"
FT                   /function="2.2.1.2 : Aspartate family"
FT                   /EC_number="4.1.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11856852; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85281"
FT                   /db_xref="GOA:Q3IJ29"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ29"
FT                   /protein_id="CAI85281.1"
FT                   /translation="MSFLSTGVKTAINELSSQLDSPFFVYDLDTLNSHLAQLVAQTEVK
FT                   LWYAVKANPLSKIIQCLDNAGFNFDVASKGELEQVLAQGVSSDRVLNTGPAKSPKQIKH
FT                   FIERGVRTFVAESINQVRWLNEQAKLQNCQLQVLLRVQLRWPEGEKNPLGGDSLTPFGL
FT                   GCTEWQALNITDYDALSFDGLHIFQWGNMLSTQKLSELWSQMIAPLSQLARDLNINLKI
FT                   LDLGGGLGIPYTQNDITLNWDDLITALAKIKKQAGVEELWMELGRYAVGECGHYAAPVV
FT                   ERKQNYGQQQVILSGGINHLLRPAVTSQDFPAALLRDSHTPTQAMSLYGPLCTALDSLG
FT                   EHALPSDLNEHDWLVFSQCGAYGFSESMPYFLCHELAGEYVLEQNKLSCLRAAEDASYY
FT                   LR"
     MSFLSTGVKT AINELSSQLD SPFFVYDLDT LNSHLAQLVA QTEVKLWYAV KANPLSKIIQ        60
     CLDNAGFNFD VASKGELEQV LAQGVSSDRV LNTGPAKSPK QIKHFIERGV RTFVAESINQ       120
     VRWLNEQAKL QNCQLQVLLR VQLRWPEGEK NPLGGDSLTP FGLGCTEWQA LNITDYDALS       180
     FDGLHIFQWG NMLSTQKLSE LWSQMIAPLS QLARDLNINL KILDLGGGLG IPYTQNDITL       240
     NWDDLITALA KIKKQAGVEE LWMELGRYAV GECGHYAAPV VERKQNYGQQ QVILSGGINH       300
     LLRPAVTSQD FPAALLRDSH TPTQAMSLYG PLCTALDSLG EHALPSDLNE HDWLVFSQCG       360
     AYGFSESMPY FLCHELAGEY VLEQNKLSCL RAAEDASYYL R                           401
//

If you have problems or comments...

PBIL Back to PBIL home page