(data stored in ACNUC7421 zone)

EMBL: CR954246.DEF

CR954246.DEF         Location/Qualifiers
FT   CDS             complement(26385..26888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="PSHAa0023"
FT                   /product="N-terminal methionine peptide deformylase"
FT                   /function="3.3.6.2 : Chemical modifications"
FT                   /EC_number="3.5.1.88"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9374870; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85137"
FT                   /db_xref="GOA:Q3IDI2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDI2"
FT                   /protein_id="CAI85137.1"
FT                   /translation="MATLEVLRFPDERLRTIAQEVAHVDDQVRVIIKDMLETMYDENGI
FT                   GLAATQVNIHQRIVVIDVSEERNEPLVLINPQIIKKDGTTVSEEGCLSVPNSYAKVDRA
FT                   ETVTVAALNEQGEEFVLDADELLAICIQHELDHLQGKLFIDYLSPLKRQRIRKKLEKEA
FT                   KFAE"
     MATLEVLRFP DERLRTIAQE VAHVDDQVRV IIKDMLETMY DENGIGLAAT QVNIHQRIVV        60
     IDVSEERNEP LVLINPQIIK KDGTTVSEEG CLSVPNSYAK VDRAETVTVA ALNEQGEEFV       120
     LDADELLAIC IQHELDHLQG KLFIDYLSPL KRQRIRKKLE KEAKFAE                     167
//

If you have problems or comments...

PBIL Back to PBIL home page