(data stored in ACNUC7421 zone)

EMBL: CR954246.DIPZ

CR954246.DIPZ        Location/Qualifiers
FT   CDS             275826..277637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dipZ"
FT                   /locus_tag="PSHAa0263"
FT                   /product="thiol:disulfide interchange protein[Precursor]
FT                   (Protein-disulfide reductase) (Disulfide reductase) (C-type
FT                   cytochrome biogenesis protein cycZ) (Inner membrane copper
FT                   tolerance protein)"
FT                   /function="1.4.2 : Electron transport"
FT                   /function="2.8 : Metabolism of sulfur"
FT                   /EC_number="1.8.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7623667, 7628442; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85362"
FT                   /db_xref="GOA:Q3IDT3"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT3"
FT                   /protein_id="CAI85362.1"
FT                   /translation="MRFFFLLLVALLAAPAKANNILGDLLAPPQQTFLQVDQAFVFDFD
FT                   QQDNTLFIGWDIAPEYYLYKNKIEIIAKGANIEVGDLGNGEVIEDEFFGKTEVFFNALS
FT                   IVSKLSNVTEGAVVKVRYQGCAEAGLCYPPEVISIPLNKIAGEQLQNADDATHSATSAN
FT                   AFTALSQANAPTSNAPKKDLTFTEQLASQGLITNLLIFFVVGVGLAFTPCVFPMFPILS
FT                   SLIAGQKNLSTKKAFALSFVYIQGMAVTYAALGLVVAALGGQVQGYLQHPYVLISFSLL
FT                   FVLLAMSMFGWYEIKLPSGMMNKLTQVSNNQKGGNYVGVFLMGVLSGLIASPCTTAPLS
FT                   AALLFVAQSGDYLVGGLTLYVLSLGMGLPLLLLGTSGGKLLPKAGGWMEQVKTLFGFIM
FT                   LVVPLILLERLLDADVILLMAGVLALATALYLHHWQSSQTQGKLKTALWFAATLLVVSG
FT                   FNLTKNYFWPVHMQTMQVSAQSNEFKQVANLTELKAAVAHANEQGRLVMVDLYADWCIA
FT                   CKEFEHYTFPDAKVQNEFSHFELIQVDLTDSDNKTIELMEEYTVFGLPSILFFNTQGEE
FT                   LSAQRVTGFLNAEDFAQHLSTVRASVK"
     MRFFFLLLVA LLAAPAKANN ILGDLLAPPQ QTFLQVDQAF VFDFDQQDNT LFIGWDIAPE        60
     YYLYKNKIEI IAKGANIEVG DLGNGEVIED EFFGKTEVFF NALSIVSKLS NVTEGAVVKV       120
     RYQGCAEAGL CYPPEVISIP LNKIAGEQLQ NADDATHSAT SANAFTALSQ ANAPTSNAPK       180
     KDLTFTEQLA SQGLITNLLI FFVVGVGLAF TPCVFPMFPI LSSLIAGQKN LSTKKAFALS       240
     FVYIQGMAVT YAALGLVVAA LGGQVQGYLQ HPYVLISFSL LFVLLAMSMF GWYEIKLPSG       300
     MMNKLTQVSN NQKGGNYVGV FLMGVLSGLI ASPCTTAPLS AALLFVAQSG DYLVGGLTLY       360
     VLSLGMGLPL LLLGTSGGKL LPKAGGWMEQ VKTLFGFIML VVPLILLERL LDADVILLMA       420
     GVLALATALY LHHWQSSQTQ GKLKTALWFA ATLLVVSGFN LTKNYFWPVH MQTMQVSAQS       480
     NEFKQVANLT ELKAAVAHAN EQGRLVMVDL YADWCIACKE FEHYTFPDAK VQNEFSHFEL       540
     IQVDLTDSDN KTIELMEEYT VFGLPSILFF NTQGEELSAQ RVTGFLNAED FAQHLSTVRA       600
     SVK                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page