(data stored in ACNUC7421 zone)

EMBL: CR954246.DNAA

CR954246.DNAA        Location/Qualifiers
FT   CDS             118..1542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PSHAa0001"
FT                   /product="DNA replication initiator protein,
FT                   transcriptional regulator of replication and other genes;
FT                   binds DNA at DnaA boxes, binds cardiolipin and other acidic
FT                   phospholipids, binds ATP"
FT                   /function="3.1.1 : DNA replication"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12742018, 12864864, 12941279, 14523560; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85115"
FT                   /db_xref="GOA:Q3IDF0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF0"
FT                   /protein_id="CAI85115.1"
FT                   /translation="MMCGNKNYISGSLTVYLSVWQSCLYVLQDELPSQQFSMWVRPLQA
FT                   ESTEDTLTIYAPNRFVLDWVREKYLNRINELLVEICGVEAPELRFDVGSKPLLNAQPVS
FT                   VAGTQSAPTTQAKQQSRQPKPVVEPAPKSEYKSNIKENYTFDSFVEGKSNQLAKAAATQ
FT                   VADNPGAAFNPVFIYGGTGLGKTHLLHAVGNGILANKPDAKIVYMHSERFVQDMVKALQ
FT                   NNAIEEFKRYYRSVDALMIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKE
FT                   IEGVEDRLKSRFGWGLTIAIEPPELETRVAILMKKAQQSKINLPHEVAFFIAKKLRSNV
FT                   RELEGALNRVIANANFTGRPISIDFVKEALRDLLALQDKLVTIDNIQRTVAEYYRIRIS
FT                   DLLSKRRSRSIARPRQVAMALSKELTNHSLPEIGDAFGGRDHTTVLHACRKVKSLRDES
FT                   HEIKEDYQNLIRTLSS"
     MMCGNKNYIS GSLTVYLSVW QSCLYVLQDE LPSQQFSMWV RPLQAESTED TLTIYAPNRF        60
     VLDWVREKYL NRINELLVEI CGVEAPELRF DVGSKPLLNA QPVSVAGTQS APTTQAKQQS       120
     RQPKPVVEPA PKSEYKSNIK ENYTFDSFVE GKSNQLAKAA ATQVADNPGA AFNPVFIYGG       180
     TGLGKTHLLH AVGNGILANK PDAKIVYMHS ERFVQDMVKA LQNNAIEEFK RYYRSVDALM       240
     IDDIQFFANK ERSQEEFFHT FNALLEGNQQ IILTSDRYPK EIEGVEDRLK SRFGWGLTIA       300
     IEPPELETRV AILMKKAQQS KINLPHEVAF FIAKKLRSNV RELEGALNRV IANANFTGRP       360
     ISIDFVKEAL RDLLALQDKL VTIDNIQRTV AEYYRIRISD LLSKRRSRSI ARPRQVAMAL       420
     SKELTNHSLP EIGDAFGGRD HTTVLHACRK VKSLRDESHE IKEDYQNLIR TLSS             474
//

If you have problems or comments...

PBIL Back to PBIL home page