(data stored in ACNUC7421 zone)

EMBL: CR954246.DNAG

CR954246.DNAG        Location/Qualifiers
FT   CDS             complement(363807..365558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="PSHAa0350"
FT                   /product="DNA primase"
FT                   /function="3.1.1 : DNA replication"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 6186393; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85448"
FT                   /db_xref="GOA:Q3IIB8"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIB8"
FT                   /protein_id="CAI85448.1"
FT                   /translation="MAGKIPRNFIDDLLARTDIVDLIDSKVGLKKAGKDYQACCPFHNE
FT                   KSPSFTVSQDKQFYHCFGCGVNGNAISFVMEYEKLEFVDAIEELASLLNLEVPREQGSG
FT                   SAPERTAAQKRSDYDLMLHTARFYQHQLKHHSNSAAVIEYVKGRGLSGEIVKKFMIGYA
FT                   PSEWDGLCLQLGRNKEQKEQLVELKLASEKTPGRQFDFFRDRLMFPIRDKRGRVVAFGG
FT                   RVMQADQGPKYLNSPETRIFHKGFELYGLYEAKQAHKKLDHVLIVEGYMDVVALAEQGI
FT                   EYAVAALGTATTSEHMHTLFRTTDKVICCYDGDRAGRDAAWRALENALPYLNDGKALNF
FT                   VFLPDGEDPDSLVQAEGKDKFEQRLNAADDFTKVLFNKLSLEIDLTLDSGKAKLLSAAL
FT                   PLIEKIPSEFYQENILEQLGRLIGRTREQLNNRLKTPKQQHSIERKFKITPMRQAIGIL
FT                   IQHPQMAKSVPYLPDLAQMNIAGIGLLLRLQHQALQKEDVTTAQLLEFFRGTDDYDPLT
FT                   KLATWQHQINEERLETVFQNTFKFIEDQCLNYRLETLLIKDKTQGLNSDERLECHLLMT
FT                   ALKATNS"
     MAGKIPRNFI DDLLARTDIV DLIDSKVGLK KAGKDYQACC PFHNEKSPSF TVSQDKQFYH        60
     CFGCGVNGNA ISFVMEYEKL EFVDAIEELA SLLNLEVPRE QGSGSAPERT AAQKRSDYDL       120
     MLHTARFYQH QLKHHSNSAA VIEYVKGRGL SGEIVKKFMI GYAPSEWDGL CLQLGRNKEQ       180
     KEQLVELKLA SEKTPGRQFD FFRDRLMFPI RDKRGRVVAF GGRVMQADQG PKYLNSPETR       240
     IFHKGFELYG LYEAKQAHKK LDHVLIVEGY MDVVALAEQG IEYAVAALGT ATTSEHMHTL       300
     FRTTDKVICC YDGDRAGRDA AWRALENALP YLNDGKALNF VFLPDGEDPD SLVQAEGKDK       360
     FEQRLNAADD FTKVLFNKLS LEIDLTLDSG KAKLLSAALP LIEKIPSEFY QENILEQLGR       420
     LIGRTREQLN NRLKTPKQQH SIERKFKITP MRQAIGILIQ HPQMAKSVPY LPDLAQMNIA       480
     GIGLLLRLQH QALQKEDVTT AQLLEFFRGT DDYDPLTKLA TWQHQINEER LETVFQNTFK       540
     FIEDQCLNYR LETLLIKDKT QGLNSDERLE CHLLMTALKA TNS                         583
//

If you have problems or comments...

PBIL Back to PBIL home page