(data stored in ACNUC7421 zone)

EMBL: CR954246.DNAN

CR954246.DNAN        Location/Qualifiers
FT   CDS             1556..2659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PSHAa0002"
FT                   /product="DNA polymerase III, beta-subunit; processivity
FT                   clamp of DNA polymerase III"
FT                   /function="3.1.1 : DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12028381, 12100549, 12511510; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85116"
FT                   /db_xref="GOA:Q3IDE9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDE9"
FT                   /protein_id="CAI85116.1"
FT                   /translation="MQITISRQQFLKPLVQVSGAIERKHTLPILSNVLLAVENGQLSMT
FT                   GTDLEIELVASVFVGDDIADTKLTLPAKKLLDICKSLPDGSDLTLSLQEHQLLLTSGKS
FT                   RFSLTTLAAEDFPNLEQWDGEVEFQLTRLELRKLLESTHFSMANQDVRYYLNGMSFEVD
FT                   NTDIKTVATDGHRLAIAQKQLKQSLNTQRQLIIPRKGVQEIMRLMVADEELVTIQFGAN
FT                   HIRIIDIEFTFTSKLVDGRFPDYRRVLPRGGDKVITANREWLRSAFQRVSILSNEKFRG
FT                   VRLNLSNGLLKITANNPEQEQAEEVVEVGYEGADLEIGFNVSYVLDVLNTLKTEDVLFT
FT                   LADSNSSALIEGAGDEEAMYVVMPMRL"
     MQITISRQQF LKPLVQVSGA IERKHTLPIL SNVLLAVENG QLSMTGTDLE IELVASVFVG        60
     DDIADTKLTL PAKKLLDICK SLPDGSDLTL SLQEHQLLLT SGKSRFSLTT LAAEDFPNLE       120
     QWDGEVEFQL TRLELRKLLE STHFSMANQD VRYYLNGMSF EVDNTDIKTV ATDGHRLAIA       180
     QKQLKQSLNT QRQLIIPRKG VQEIMRLMVA DEELVTIQFG ANHIRIIDIE FTFTSKLVDG       240
     RFPDYRRVLP RGGDKVITAN REWLRSAFQR VSILSNEKFR GVRLNLSNGL LKITANNPEQ       300
     EQAEEVVEVG YEGADLEIGF NVSYVLDVLN TLKTEDVLFT LADSNSSALI EGAGDEEAMY       360
     VVMPMRL                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page