(data stored in ACNUC7421 zone)

EMBL: CR954246.DSBA

CR954246.DSBA        Location/Qualifiers
FT   CDS             260255..260878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="PSHAa0248"
FT                   /product="periplasmic protein, disulfide bond formation,"
FT                   /function="3.3.7 : Protein folding"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 1 : Function experimentally demonstrated in
FT                   the studied organism; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85351"
FT                   /db_xref="GOA:Q3ILM4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM4"
FT                   /protein_id="CAI85351.1"
FT                   /translation="MLKKLKLSLLLLCLPFAALAANFEVGNQYTVIDIEKSTTPQVTEY
FT                   FSFYCPHCFKFEPVAHAIEENLPAGAVFIKNHVNFLGGVSPQTQSNLSLAYLVAKKHGQ
FT                   ADTITDKIFKSIHVQRAPLTEIKDLKKLLDINGISSDTFDQDIASMPIIAAEQAMQDKQ
FT                   NKYSKLGALTGVPTFIVNDKYKINLNTIKSQEELDELVSFLLAL"
     MLKKLKLSLL LLCLPFAALA ANFEVGNQYT VIDIEKSTTP QVTEYFSFYC PHCFKFEPVA        60
     HAIEENLPAG AVFIKNHVNF LGGVSPQTQS NLSLAYLVAK KHGQADTITD KIFKSIHVQR       120
     APLTEIKDLK KLLDINGISS DTFDQDIASM PIIAAEQAMQ DKQNKYSKLG ALTGVPTFIV       180
     NDKYKINLNT IKSQEELDEL VSFLLAL                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page