(data stored in ACNUC7421 zone)

EMBL: CR954246.DSBC

CR954246.DSBC        Location/Qualifiers
FT   CDS             528904..529605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="PSHAa0515"
FT                   /product="disulfide bond isomerase, periplasmic; chaperone;
FT                   activated by DsbD; homodimeric"
FT                   /function="3.3 : Protein synthesis, maturation and folding"
FT                   /EC_number="5.3.4.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15220477, 15299592; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0515"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85605"
FT                   /db_xref="GOA:Q3ILE0"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE0"
FT                   /protein_id="CAI85605.1"
FT                   /translation="MLCTSLSAVANDVAVAPNANDPIVIKFAALGVTVKQINPSPVAGL
FT                   KELITNQGVLYASPDGQFLMQGTLIDLNNRSNLTEKALNGVRQAGLKEYEDSMIVYKAP
FT                   NEKHSITVFTDISCGYCRKLHRELDDLLEAGITVKYLAFPRGGLQGSGYNDLMNVWCAK
FT                   DQQEALTEAKSGSNTTAVKGCSAPVAEHYQLGQSFGVTGTPAIILEDGTMIPGYQPAAA
FT                   LSAALNASKAP"
     MLCTSLSAVA NDVAVAPNAN DPIVIKFAAL GVTVKQINPS PVAGLKELIT NQGVLYASPD        60
     GQFLMQGTLI DLNNRSNLTE KALNGVRQAG LKEYEDSMIV YKAPNEKHSI TVFTDISCGY       120
     CRKLHRELDD LLEAGITVKY LAFPRGGLQG SGYNDLMNVW CAKDQQEALT EAKSGSNTTA       180
     VKGCSAPVAE HYQLGQSFGV TGTPAIILED GTMIPGYQPA AALSAALNAS KAP              233
//

If you have problems or comments...

PBIL Back to PBIL home page