(data stored in ACNUC7421 zone)

EMBL: CR954246.DTD

CR954246.DTD         Location/Qualifiers
FT   CDS             181555..181992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="PSHAa0172"
FT                   /product="D-Tyr-tRNA(Tyr) deacylase; removes other
FT                   D-aminoacids from mischarged tRNA"
FT                   /function="3.2.1.3.3 : Other"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14527667; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85275"
FT                   /db_xref="GOA:Q3IJ42"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ42"
FT                   /protein_id="CAI85275.1"
FT                   /translation="MQGLIQRVKHAKVEINNQVVGEIGQGILVLLGVEKQDDEQAADKL
FT                   LHKISNYRIFTDENDKMNLSLKDIAGELLVVSQFTLAANTKKGMRPSFSSAATPSQANE
FT                   LYEYFVAQAKALNLTVAAGEFGADMQVSLCNDGPVTFNLAV"
     MQGLIQRVKH AKVEINNQVV GEIGQGILVL LGVEKQDDEQ AADKLLHKIS NYRIFTDEND        60
     KMNLSLKDIA GELLVVSQFT LAANTKKGMR PSFSSAATPS QANELYEYFV AQAKALNLTV       120
     AAGEFGADMQ VSLCNDGPVT FNLAV                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page