(data stored in ACNUC7421 zone)

EMBL: CR954246.DUSA

CR954246.DUSA        Location/Qualifiers
FT   CDS             515246..516178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="PSHAa0499"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11983710; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85589"
FT                   /db_xref="GOA:Q3IG92"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IG92"
FT                   /protein_id="CAI85589.1"
FT                   /translation="MLDWTDRHCRTFHRKMTKHTVLYTEMITTGAILFGRGDYLHFNQH
FT                   EGPVALQLGGSDPQALAQCAKLAGERGYDEINLNVGCPSDRVQNGRFGACLMGEPQLVA
FT                   DCVAAMKAEVNIPVTVKTRIGIDEQDSYEFLCALIEASHNVGCDDFIIHARKAWLKGLS
FT                   PKENREVPPLDYPRVYQLKKDYPQLDLSLNGGVKTIEQSLEHLQHIDGVMIGREAYSNP
FT                   FILNEVDEKIYGDIANTQSRHDVVRSMYSYIEDEMRLGANFWHVARHMLGIFQGQPGAR
FT                   GFRRHLSENGHGKQADLSVMDKALSFVPE"
     MLDWTDRHCR TFHRKMTKHT VLYTEMITTG AILFGRGDYL HFNQHEGPVA LQLGGSDPQA        60
     LAQCAKLAGE RGYDEINLNV GCPSDRVQNG RFGACLMGEP QLVADCVAAM KAEVNIPVTV       120
     KTRIGIDEQD SYEFLCALIE ASHNVGCDDF IIHARKAWLK GLSPKENREV PPLDYPRVYQ       180
     LKKDYPQLDL SLNGGVKTIE QSLEHLQHID GVMIGREAYS NPFILNEVDE KIYGDIANTQ       240
     SRHDVVRSMY SYIEDEMRLG ANFWHVARHM LGIFQGQPGA RGFRRHLSEN GHGKQADLSV       300
     MDKALSFVPE                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page