(data stored in ACNUC7421 zone)

EMBL: CR954246.DUSB

CR954246.DUSB        Location/Qualifiers
FT   CDS             complement(359619..360599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="PSHAa0347"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /function="3.2.3.1 : tRNA modifications"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85445"
FT                   /db_xref="GOA:Q3IIC1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC1"
FT                   /protein_id="CAI85445.1"
FT                   /translation="MNIVRIGKYQLENNVIVAPMAGVTDRPFRQLCRRLGAGLAVSEML
FT                   SSNPDVWKTEKSMNRMDHSGESGIRAVQIAGADPELMAQAAQFNVANGAQIIDINMGCP
FT                   AKKVNKKLAGSALLQFPELVEEIIDAVVNAVDIPVTLKIRTGWDLDNRNGVEIARIAER
FT                   YGIASLAVHGRTRACMYKGEAEYATIRDIKRSVSIPVVANGDITSPEKAKQVLDYTGAD
FT                   AIMIGRAAQGRPWIFREIDHYLRTGEHLQPPAIAEVRSILMEHLTNLHTFYGEPMGARI
FT                   ARKHVSWYLQTHDRDGQFRRVFNTIDNPLTQVDVLEQYFKTLAAN"
     MNIVRIGKYQ LENNVIVAPM AGVTDRPFRQ LCRRLGAGLA VSEMLSSNPD VWKTEKSMNR        60
     MDHSGESGIR AVQIAGADPE LMAQAAQFNV ANGAQIIDIN MGCPAKKVNK KLAGSALLQF       120
     PELVEEIIDA VVNAVDIPVT LKIRTGWDLD NRNGVEIARI AERYGIASLA VHGRTRACMY       180
     KGEAEYATIR DIKRSVSIPV VANGDITSPE KAKQVLDYTG ADAIMIGRAA QGRPWIFREI       240
     DHYLRTGEHL QPPAIAEVRS ILMEHLTNLH TFYGEPMGAR IARKHVSWYL QTHDRDGQFR       300
     RVFNTIDNPL TQVDVLEQYF KTLAAN                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page