(data stored in ACNUC7421 zone)

EMBL: CR954246.EFP

CR954246.EFP         Location/Qualifiers
FT   CDS             492054..492620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="PSHAa0474"
FT                   /product="elongation factor P (EF-P)"
FT                   /function="3.3 : Protein synthesis, maturation and folding"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85571"
FT                   /db_xref="GOA:Q3IFP5"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFP5"
FT                   /protein_id="CAI85571.1"
FT                   /translation="MANYSTNEFKGGLKIMMDGEPSSIIENEMVKPGKGQAFNRVRIRK
FT                   LISGKVLEKTFKSGESVEGADVMDTDLAYLYTDGEFWHFMNNETFEQIAADEKALGDAG
FT                   KWLVENDVCTITLWNGNPIVVTPPNFVELEITETDPGLKGDTAGTGGKPATLSTGAVVR
FT                   VPLFVQIGEVIKVDTRNGEYVSRVK"
     MANYSTNEFK GGLKIMMDGE PSSIIENEMV KPGKGQAFNR VRIRKLISGK VLEKTFKSGE        60
     SVEGADVMDT DLAYLYTDGE FWHFMNNETF EQIAADEKAL GDAGKWLVEN DVCTITLWNG       120
     NPIVVTPPNF VELEITETDP GLKGDTAGTG GKPATLSTGA VVRVPLFVQI GEVIKVDTRN       180
     GEYVSRVK                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page