(data stored in ACNUC7421 zone)

EMBL: CR954246.EXED

CR954246.EXED        Location/Qualifiers
FT   CDS             245801..247867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exeD"
FT                   /locus_tag="PSHAa0232"
FT                   /product="General secretion pathway protein D"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7789814; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85335"
FT                   /db_xref="GOA:Q3ILP0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILP0"
FT                   /protein_id="CAI85335.1"
FT                   /translation="MVQALHLTKIKKGLAKYAALFLAASISFSVAAVEYAANFKGTDIN
FT                   EFINIVGKNLNKTIIIDPNVRGKVNVRSYELMGEALYYQFFLNVLEVYGYSAIEMDNNI
FT                   IKIEKSSDAKKSNVPLITDGSEASGDMMITRVVRVKNVSVQELGPLVRQFSDQKDGGHV
FT                   ANFNAANVMMLTGHAASVNRLVEIIRSVDQAGDKRVDIVKLKFATADDVVSVVDNIYKD
FT                   SGKGSIPEFLIPKVVADGRTNSVIVSGEGQARTRAIELIKRLDGELESQGNTKVFYLNY
FT                   AKAEDLVKVLQGVSKSLTDDTQGGSATKTRTRSNNETSIEAHPDSNSLIITAQPDTMRS
FT                   LESVIERLDIRRAQVLVEAIIIEVMEGDGINFGLQWISEQGGMLQFNNGTTVPVGALAV
FT                   AAEQARDTTVSKNIIGTESGTITQVDETTKGDYGPLASLLGGINGLAMGVIKNDWGAIV
FT                   QAVSTDSNSNILATPSITTMDNEEASILVGQEVPIITGSQTGSNNTNPFQTVERQEVGI
FT                   KLKVTPQINDGSAVQLTIEQEVSSVSGATAVDISVNKRSIKTTVMADDGGMVVLGGLID
FT                   EDVQESVSKVPLLGDIPILGHLFKSTNTTRRKRNLIVFIRPTIIRDGISMNKLSFNKYN
FT                   FIRGEQFKQREDGIELMPRTDTPILPEWNDELILPPTYEEHLRKQNAQERKDD"
     MVQALHLTKI KKGLAKYAAL FLAASISFSV AAVEYAANFK GTDINEFINI VGKNLNKTII        60
     IDPNVRGKVN VRSYELMGEA LYYQFFLNVL EVYGYSAIEM DNNIIKIEKS SDAKKSNVPL       120
     ITDGSEASGD MMITRVVRVK NVSVQELGPL VRQFSDQKDG GHVANFNAAN VMMLTGHAAS       180
     VNRLVEIIRS VDQAGDKRVD IVKLKFATAD DVVSVVDNIY KDSGKGSIPE FLIPKVVADG       240
     RTNSVIVSGE GQARTRAIEL IKRLDGELES QGNTKVFYLN YAKAEDLVKV LQGVSKSLTD       300
     DTQGGSATKT RTRSNNETSI EAHPDSNSLI ITAQPDTMRS LESVIERLDI RRAQVLVEAI       360
     IIEVMEGDGI NFGLQWISEQ GGMLQFNNGT TVPVGALAVA AEQARDTTVS KNIIGTESGT       420
     ITQVDETTKG DYGPLASLLG GINGLAMGVI KNDWGAIVQA VSTDSNSNIL ATPSITTMDN       480
     EEASILVGQE VPIITGSQTG SNNTNPFQTV ERQEVGIKLK VTPQINDGSA VQLTIEQEVS       540
     SVSGATAVDI SVNKRSIKTT VMADDGGMVV LGGLIDEDVQ ESVSKVPLLG DIPILGHLFK       600
     STNTTRRKRN LIVFIRPTII RDGISMNKLS FNKYNFIRGE QFKQREDGIE LMPRTDTPIL       660
     PEWNDELILP PTYEEHLRKQ NAQERKDD                                          688
//

If you have problems or comments...

PBIL Back to PBIL home page