(data stored in ACNUC7421 zone)

EMBL: CR954246.EXEE

CR954246.EXEE        Location/Qualifiers
FT   CDS             247860..249425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exeE"
FT                   /locus_tag="PSHAa0233"
FT                   /product="General secretion pathway protein E (Type II
FT                   traffic warden ATPase)"
FT                   /function="1.6.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1640836; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85336"
FT                   /db_xref="GOA:Q3ILN9"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN9"
FT                   /protein_id="CAI85336.1"
FT                   /translation="MTKAIAEINQDVVHPNAHHPDELLTSDDLVELPAKRLPFSYARRA
FT                   GVLLSKNKEQRIVYYRGELDIDVLLEVRRIAGHGFTLEQLADDKFELLLEASYQRDSSE
FT                   TQQMMEDIGNEVDLFSLVDELPQTEDLLAGDDDAPIIKLINAMLSEAIKEGASDIHIET
FT                   FEQELVIRFRVDGVLKEVLKPNRKLASLLVSRIKVMAKLDIAEKRIPQDGRISLRIAGR
FT                   AVDVRVSTMPSSFGERVVLRLLDKNNAHLNLEDLGMTAQNRELFANLISKPHGIILVTG
FT                   PTGSGKSTTLYAGMSQINSRDRNILTVEDPIEYEIPGIGQTQVNTKVGMTFARGLRAIL
FT                   RQDPDVVMVGEIRDLETAQIGVQASLTGHLVMSTLHTNTASGAITRMEDMGVEPFLLSS
FT                   SLLGVLSQRLVRTLCKNCKKEHVADERECQLLGVPFESKPTIHRAVGCEACNFNGYKGR
FT                   TGIHELLVVDETIREMIHNGKGEQSVEKYIRKLSPSIRQDGCSRVLAGKTTLEEVLRVT
FT                   REEG"
     MTKAIAEINQ DVVHPNAHHP DELLTSDDLV ELPAKRLPFS YARRAGVLLS KNKEQRIVYY        60
     RGELDIDVLL EVRRIAGHGF TLEQLADDKF ELLLEASYQR DSSETQQMME DIGNEVDLFS       120
     LVDELPQTED LLAGDDDAPI IKLINAMLSE AIKEGASDIH IETFEQELVI RFRVDGVLKE       180
     VLKPNRKLAS LLVSRIKVMA KLDIAEKRIP QDGRISLRIA GRAVDVRVST MPSSFGERVV       240
     LRLLDKNNAH LNLEDLGMTA QNRELFANLI SKPHGIILVT GPTGSGKSTT LYAGMSQINS       300
     RDRNILTVED PIEYEIPGIG QTQVNTKVGM TFARGLRAIL RQDPDVVMVG EIRDLETAQI       360
     GVQASLTGHL VMSTLHTNTA SGAITRMEDM GVEPFLLSSS LLGVLSQRLV RTLCKNCKKE       420
     HVADERECQL LGVPFESKPT IHRAVGCEAC NFNGYKGRTG IHELLVVDET IREMIHNGKG       480
     EQSVEKYIRK LSPSIRQDGC SRVLAGKTTL EEVLRVTREE G                           521
//

If you have problems or comments...

PBIL Back to PBIL home page