(data stored in ACNUC7421 zone)

EMBL: CR954246.FADA

CR954246.FADA        Location/Qualifiers
FT   CDS             complement(11474..12643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="PSHAa0010"
FT                   /product="3-ketoacyl-CoA thiolase; (thiolase I, acetyl-CoA
FT                   transferase), in complex with FadB catalyzes EC 2.3.1.16"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="2.3.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8446033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85124"
FT                   /db_xref="GOA:Q3IJ24"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ24"
FT                   /protein_id="CAI85124.1"
FT                   /translation="MNNPVIVDCIRTPMGRSKGGVFKNKRAEDLSAHLMKGLLDRNPAV
FT                   DPASIDDIYWGCVQQTLEQGFNVARNAALLAGIPHSVPAVTVNRLCGSSMQALHDAARA
FT                   IMTGAGDTYLIGGVEHMGHVPMTHGNDFHPGLATSIAQAAGSMGLTAEYLATLHGISRE
FT                   QQDEFAYRSHQRAQAATVEGRFRREILAMEGHAADGSLILVEDDEVIRPETTVEGLSKL
FT                   RPVFNPASGTVTAGTSSALSDGASAMLVMSEAKAKELGLPIRARIKAMAVAGCDPSIMG
FT                   YGPVPASKKALAQAGITIDDLGVVELNEAFAAQSLPVMKDLGLMDVVDEKVNLNGGAIA
FT                   LGHPLGCSGSRISTSLIHLMEDKNVRYGLATMCIGLGQGIATVFERVQD"
     MNNPVIVDCI RTPMGRSKGG VFKNKRAEDL SAHLMKGLLD RNPAVDPASI DDIYWGCVQQ        60
     TLEQGFNVAR NAALLAGIPH SVPAVTVNRL CGSSMQALHD AARAIMTGAG DTYLIGGVEH       120
     MGHVPMTHGN DFHPGLATSI AQAAGSMGLT AEYLATLHGI SREQQDEFAY RSHQRAQAAT       180
     VEGRFRREIL AMEGHAADGS LILVEDDEVI RPETTVEGLS KLRPVFNPAS GTVTAGTSSA       240
     LSDGASAMLV MSEAKAKELG LPIRARIKAM AVAGCDPSIM GYGPVPASKK ALAQAGITID       300
     DLGVVELNEA FAAQSLPVMK DLGLMDVVDE KVNLNGGAIA LGHPLGCSGS RISTSLIHLM       360
     EDKNVRYGLA TMCIGLGQGI ATVFERVQD                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page