(data stored in ACNUC7421 zone)

EMBL: CR954246.FADB

CR954246.FADB        Location/Qualifiers
FT   CDS             complement(12648..14807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="PSHAa0011"
FT                   /product="multifunctional 3-hydroxybutyryl-CoA epimerase,
FT                   delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase, enoyl-CoA
FT                   hydratase (N-terminal); 3-hydroxyacyl-CoA dehydrogenase
FT                   (C-terminal)"
FT                   /function="2.4.1.1 : Biosynthesis"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="5.3.3.8"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="5.1.2.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8446033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85125"
FT                   /db_xref="GOA:Q3IJ23"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ23"
FT                   /protein_id="CAI85125.1"
FT                   /translation="MLYKSDSFEVSFIKENIAEFKFCATASVNTLSQQTLSDCATALKQ
FT                   LAANTDIKGMIFTSDKEHFIIGADVFEFLPIFTRSEAELVTWIKEATDVFDAIEDLPFP
FT                   TLSAVNGLALGGGCEWVLATDYRVASETAQMGLPEVTLGIMPGFGGTVRLPRIIGADNA
FT                   MMWITSGSTNRAADALKVGAFDAVVSADKLIESSVSTLELAIAGKLDWQAKRNVKLQPL
FT                   KLNRVEQGMSFAMAEGMVMAKTKGHYPAPVMAVKTIKAAANCTRDEAMAIENANFAKLA
FT                   GTPEVAAQIGIFLADQYIKGKSRKLAKQSDVEIKQAAVLGAGIMGGGIAYQSAYKGTPI
FT                   IMKDIQQDALDLGMGEASKLLGQKVKRGHMSMEKMLGTLSKIKPTLNDSDLQSADIIVE
FT                   AVVENPKVKQAVLAELEKTMPEGTVLTSNTSTICIDLLAEALDKPENFCGMHFFNPVPK
FT                   MPLVEIIRGAKTSDKTINAVVDYALKLGKSPIVVNDCPGFFVNRVLFPYFAGFSKLVVE
FT                   GANFAKVDKVMENVFGWPMGPAYLLDVVGIDTAFHCTGVMADGFPERMARADKDPVTIF
FT                   ANEKRFGQKNKAGFYKYETDRRGRLKKSHDETAIELLKPITEAEKAFDKQEIIDRCMIP
FT                   MLNEVLLCLQEGIVASPQEADMALVYGVGFPPFRGGAFRYLDQTGLANFVATADKYAHL
FT                   GAIYQVSEQTRQWAEEGRVFYKVEG"
     MLYKSDSFEV SFIKENIAEF KFCATASVNT LSQQTLSDCA TALKQLAANT DIKGMIFTSD        60
     KEHFIIGADV FEFLPIFTRS EAELVTWIKE ATDVFDAIED LPFPTLSAVN GLALGGGCEW       120
     VLATDYRVAS ETAQMGLPEV TLGIMPGFGG TVRLPRIIGA DNAMMWITSG STNRAADALK       180
     VGAFDAVVSA DKLIESSVST LELAIAGKLD WQAKRNVKLQ PLKLNRVEQG MSFAMAEGMV       240
     MAKTKGHYPA PVMAVKTIKA AANCTRDEAM AIENANFAKL AGTPEVAAQI GIFLADQYIK       300
     GKSRKLAKQS DVEIKQAAVL GAGIMGGGIA YQSAYKGTPI IMKDIQQDAL DLGMGEASKL       360
     LGQKVKRGHM SMEKMLGTLS KIKPTLNDSD LQSADIIVEA VVENPKVKQA VLAELEKTMP       420
     EGTVLTSNTS TICIDLLAEA LDKPENFCGM HFFNPVPKMP LVEIIRGAKT SDKTINAVVD       480
     YALKLGKSPI VVNDCPGFFV NRVLFPYFAG FSKLVVEGAN FAKVDKVMEN VFGWPMGPAY       540
     LLDVVGIDTA FHCTGVMADG FPERMARADK DPVTIFANEK RFGQKNKAGF YKYETDRRGR       600
     LKKSHDETAI ELLKPITEAE KAFDKQEIID RCMIPMLNEV LLCLQEGIVA SPQEADMALV       660
     YGVGFPPFRG GAFRYLDQTG LANFVATADK YAHLGAIYQV SEQTRQWAEE GRVFYKVEG        719
//

If you have problems or comments...

PBIL Back to PBIL home page