(data stored in ACNUC7421 zone)

EMBL: CR954246.FBP

CR954246.FBP         Location/Qualifiers
FT   CDS             complement(480524..481492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="PSHAa0463"
FT                   /product="Fructose-1,6-bisphosphatase"
FT                   /function="2.1.1.1 : Glycolysis/gluconeogenesis"
FT                   /EC_number="3.1.3.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2843822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85560"
FT                   /db_xref="GOA:Q3IFQ5"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IFQ5"
FT                   /protein_id="CAI85560.1"
FT                   /translation="MRRLPPVLLEDGCPRELISLIRTILAACKEISFRVGQGELSGVLG
FT                   STLDENIQGETQKKLDVLTNQLLKDILLESGYVKAIASEEEDYTVAGNPDAEYIVAFDP
FT                   LDGSSNTDINSLVGTIFSVMKAPEGADPADQSIFMQPGINQVAAGYVLYGPSTILALTT
FT                   GKGTRFFTLDKTHGTFLLTQDFAKIPADTNEYAINASNQRHWQPAMQNYINDLVAGDTG
FT                   PRARNFNMRWIAAMVGDVHRVLSRGGLFTYPTDTKNPSQPNKLRLLYEANPMAMLVEQA
FT                   GGIASTGTERIMDIQPNAIHQRVAVILGSKNEVETCLGYHK"
     MRRLPPVLLE DGCPRELISL IRTILAACKE ISFRVGQGEL SGVLGSTLDE NIQGETQKKL        60
     DVLTNQLLKD ILLESGYVKA IASEEEDYTV AGNPDAEYIV AFDPLDGSSN TDINSLVGTI       120
     FSVMKAPEGA DPADQSIFMQ PGINQVAAGY VLYGPSTILA LTTGKGTRFF TLDKTHGTFL       180
     LTQDFAKIPA DTNEYAINAS NQRHWQPAMQ NYINDLVAGD TGPRARNFNM RWIAAMVGDV       240
     HRVLSRGGLF TYPTDTKNPS QPNKLRLLYE ANPMAMLVEQ AGGIASTGTE RIMDIQPNAI       300
     HQRVAVILGS KNEVETCLGY HK                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page