(data stored in ACNUC7421 zone)

EMBL: CR954246.FIS

CR954246.FIS         Location/Qualifiers
FT   CDS             complement(359309..359599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="PSHAa0346"
FT                   /product="DNA-binding protein for site-specific
FT                   recombination and inversion, transcription of rRNA and tRNA
FT                   operons, and DNA replication"
FT                   /function="3.2.1.1.1 : Regulatory proteins (DNA
FT                   interaction)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2835774, 2837762, 1459953; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85444"
FT                   /db_xref="GOA:Q3IIC2"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IIC2"
FT                   /protein_id="CAI85444.1"
FT                   /translation="MFEQNVTSPFITNPHVQAHEKPQPLRDAVKKAVHHYLKQLNGQDV
FT                   QDVYDLVLSELEAPLLEEVMTYTRGNQTRAAILLGINRGTLRKKLKKYGMN"
     MFEQNVTSPF ITNPHVQAHE KPQPLRDAVK KAVHHYLKQL NGQDVQDVYD LVLSELEAPL        60
     LEEVMTYTRG NQTRAAILLG INRGTLRKKL KKYGMN                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page