(data stored in ACNUC7421 zone)

EMBL: CR954246.FMT

CR954246.FMT         Location/Qualifiers
FT   CDS             complement(25383..26348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="PSHAa0022"
FT                   /product="10-formyltetrahydrofolate:L-methionyl-tRNA(fMet)
FT                   N-formyltransferase"
FT                   /function="3.3.6.2 : Chemical modifications"
FT                   /EC_number="2.1.2.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 769821, 769822, 98518, 8112305, 8887566; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85136"
FT                   /db_xref="GOA:Q3IDI3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IDI3"
FT                   /protein_id="CAI85136.1"
FT                   /translation="MTQPLRIIFAGTPDFAARHLQALIQSEHQIVGVYSQPDRPAGRGK
FT                   KLKASEVKELALEHNLPVFQPQSLKTEDALNELTRLNADIMIVVAYGLILPKAILDAPR
FT                   LGCLNVHGSILPRWRGAAPIQRAIWAGDEQTGVTIMQMNEGLDTGDMLHISRCPISATE
FT                   TSASLYTKLADLGPGALIDTINNLANGKITPEPQNDAAANYAKKLSKDEANIDWSMSAA
FT                   QIERNIRAFNPWPVCFTQMGGQPVKIYQAHVVEQSSSQPDNNGRVLSSDKNGVIVGCGE
FT                   HALCITQLQPQGKKPMAINDFLNGRSDWVTPGTILGENNE"
     MTQPLRIIFA GTPDFAARHL QALIQSEHQI VGVYSQPDRP AGRGKKLKAS EVKELALEHN        60
     LPVFQPQSLK TEDALNELTR LNADIMIVVA YGLILPKAIL DAPRLGCLNV HGSILPRWRG       120
     AAPIQRAIWA GDEQTGVTIM QMNEGLDTGD MLHISRCPIS ATETSASLYT KLADLGPGAL       180
     IDTINNLANG KITPEPQNDA AANYAKKLSK DEANIDWSMS AAQIERNIRA FNPWPVCFTQ       240
     MGGQPVKIYQ AHVVEQSSSQ PDNNGRVLSS DKNGVIVGCG EHALCITQLQ PQGKKPMAIN       300
     DFLNGRSDWV TPGTILGENN E                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page