(data stored in ACNUC7421 zone)

EMBL: CR954246.FOLE

CR954246.FOLE        Location/Qualifiers
FT   CDS             complement(75426..75980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="PSHAa0073"
FT                   /product="GTP cyclohydrolase I"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="3.5.4.16"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10049741, 14642352; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85182"
FT                   /db_xref="GOA:Q3IF89"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF89"
FT                   /protein_id="CAI85182.1"
FT                   /translation="MHNELKQGYENIITAVGEDPNREGLLDTPKRAAKAMEYLTQGYRQ
FT                   TLEEITNNAVFTSDADDMVLVQDIELYSMCEHHLLPFTGRCHIAYIPNGKVLGLSKFAR
FT                   IVDMFARRFQIQEQLTHQIAKAVEEVTGATGVGVIVEAKHMCMMMRGVEKQNSSMRTSV
FT                   MLGNFRADPKTRNEFLQLIKG"
     MHNELKQGYE NIITAVGEDP NREGLLDTPK RAAKAMEYLT QGYRQTLEEI TNNAVFTSDA        60
     DDMVLVQDIE LYSMCEHHLL PFTGRCHIAY IPNGKVLGLS KFARIVDMFA RRFQIQEQLT       120
     HQIAKAVEEV TGATGVGVIV EAKHMCMMMR GVEKQNSSMR TSVMLGNFRA DPKTRNEFLQ       180
     LIKG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page