(data stored in ACNUC7421 zone)

EMBL: CR954246.FOLM

CR954246.FOLM        Location/Qualifiers
FT   CDS             complement(76007..76726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folM"
FT                   /locus_tag="PSHAa0074"
FT                   /product="putative alternative dihydrofolate reductase,
FT                   NAD(P)-binding domain"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="1.1.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14617668; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85183"
FT                   /db_xref="GOA:Q3IF88"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF88"
FT                   /protein_id="CAI85183.1"
FT                   /translation="MTPPILITGAGQRIGLALAKHFIAQGQPIIITYRTRHAAVDLLEQ
FT                   QGAVCIYADFSTDDGISTFIKALKEHTNSLRAILHNASSWDCEANNANFAQLFDNMMRI
FT                   HAKTPYLINLLCAELLLNYQTEMNTPADIIHLTDYVVETGSPKHVAYAASKAALDNLTK
FT                   SFSAKYAPNIKVNSVAPSLIIFNEHDDEQYRAKTLKKSLMGIEPGCQEIINSIDLLLHS
FT                   HYITGRAIPVDGGRHLK"
     MTPPILITGA GQRIGLALAK HFIAQGQPII ITYRTRHAAV DLLEQQGAVC IYADFSTDDG        60
     ISTFIKALKE HTNSLRAILH NASSWDCEAN NANFAQLFDN MMRIHAKTPY LINLLCAELL       120
     LNYQTEMNTP ADIIHLTDYV VETGSPKHVA YAASKAALDN LTKSFSAKYA PNIKVNSVAP       180
     SLIIFNEHDD EQYRAKTLKK SLMGIEPGCQ EIINSIDLLL HSHYITGRAI PVDGGRHLK        239
//

If you have problems or comments...

PBIL Back to PBIL home page