(data stored in ACNUC7421 zone)

EMBL: CR954246.FOLX

CR954246.FOLX        Location/Qualifiers
FT   CDS             complement(75066..75422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folX"
FT                   /locus_tag="PSHAa0072"
FT                   /product="D-erythro-7,8-dihydroneopterin aldolase"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="4.1.2.25"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9651328; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85181"
FT                   /db_xref="GOA:Q3IF90"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF90"
FT                   /protein_id="CAI85181.1"
FT                   /translation="MANAIINVTNLRLRTFIGFNQEEREKKQDVVINLEIHYPAHDACK
FT                   TDEVDQALNYKVITKEVITLVEQGDFLLLEKLVAEILAVCHSHPSVHYAKARVDKPHAL
FT                   RFADSVSLTLDWAK"
     MANAIINVTN LRLRTFIGFN QEEREKKQDV VINLEIHYPA HDACKTDEVD QALNYKVITK        60
     EVITLVEQGD FLLLEKLVAE ILAVCHSHPS VHYAKARVDK PHALRFADSV SLTLDWAK         118
//

If you have problems or comments...

PBIL Back to PBIL home page