(data stored in ACNUC7421 zone)

EMBL: CR954246.FRE

CR954246.FRE         Location/Qualifiers
FT   CDS             complement(107724..108437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fre"
FT                   /locus_tag="PSHAa0104"
FT                   /product="NAD(P)H-flavin reductase"
FT                   /function="2.5.14 : Other"
FT                   /EC_number="1.16.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10960098, 12054743; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85213"
FT                   /db_xref="GOA:Q3IDJ9"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ9"
FT                   /protein_id="CAI85213.1"
FT                   /translation="MQTLKAEVVAISPLTEFVHKVILKPQQPVSFEAGQYMHLVLSEND
FT                   KRAFSIASRPSQCDQIELHIGASGTDTYAMQSLEHLRNALNEKQLIEIEAGLGISQLRL
FT                   QCERPIILLAGGTGFSYAKSMADHLAEISCDRPVLLYWGVREESALYAHREMQVWADSH
FT                   KNFQFIPVVENPSPDWQGHTGYVHKAVMQDIVSLAPYDIYMAGRFDMIGIVRDDFIAHG
FT                   AIRENMYADAFAFIK"
     MQTLKAEVVA ISPLTEFVHK VILKPQQPVS FEAGQYMHLV LSENDKRAFS IASRPSQCDQ        60
     IELHIGASGT DTYAMQSLEH LRNALNEKQL IEIEAGLGIS QLRLQCERPI ILLAGGTGFS       120
     YAKSMADHLA EISCDRPVLL YWGVREESAL YAHREMQVWA DSHKNFQFIP VVENPSPDWQ       180
     GHTGYVHKAV MQDIVSLAPY DIYMAGRFDM IGIVRDDFIA HGAIRENMYA DAFAFIK          237
//

If you have problems or comments...

PBIL Back to PBIL home page